<?xml version="1.0" encoding="UTF-8"?>
<rss version="2.0"
     xmlns:content="http://purl.org/rss/1.0/modules/content/"
     xmlns:dc="https://purl.org/dc/elements/1.1/"
     xmlns:dcterms="http://purl.org/dc/terms/"
     xmlns:media="http://search.yahoo.com/mrss/"
     xmlns:atom="http://www.w3.org/2005/Atom"
>
    <channel>
                    <atom:link href="https://www.cinemablend.com/feeds/tag/full-house" rel="self" type="application/rss+xml" />
                            <title><![CDATA[ Latest from CinemaBlend in Full-house ]]></title>
                <link>https://www.cinemablend.com/tag/full-house</link>
        <description><![CDATA[ All the latest full-house content from the CinemaBlend team ]]></description>
                                    <lastBuildDate>Sun, 24 May 2026 19:25:03 +0000</lastBuildDate>
                            <language>en</language>
                                <item>
                                                            <title><![CDATA[ Candace Cameron Bure Just Reminded Us Full House Is Over 30 Years Old, And Oh Mylanta! ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/candace-cameron-bure-reminded-us-full-house-over-30-years-old</link>
                                                                            <description>
                            <![CDATA[ Whoa baby, now I feel old. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">ZPfdBJEsScK7W9aPXhpJJk</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/N7exeZ3iQBSPka4V8mPomB-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Sun, 24 May 2026 19:25:03 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Carly Levy ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/WhWLeh9yrwXXtWqGkJnZuM.jpg ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Carly Levy has been a freelance writer for CinemaBlend starting in 2022 covering mostly movies with a sprinkle of television. After graduating at Florida Atlantic University with a degree in film and theater in 2015, she worked for a year as a journalist for Talk Media covering South Florida news. In 2017, she spent four years as a ghostwriter writing about addiction and mental health for rehab and therapy blogs. Now, she divides her time writing about the subjects of both entertainment and mental health issues.&lt;/p&gt;&lt;p&gt;&lt;br&gt;&lt;/p&gt;&lt;p&gt;&lt;strong&gt;What They&#039;re Into&lt;/strong&gt;: Carly is an avid cinephile who is always looking for the next best film to watch whether it goes back to the silent film era to what&#039;s playing in theaters. Her analytical mindset enhances her writing as she gains true understanding of the characters and stories that makes a movie great enough to write about. Her passion ranges from following film scavenger hunts on Letterboxd to discover new films and creating watchlists based on the latest trailers. She enjoys the originality and freshness indie cinema brings, particularly A24 films. During her spare time, Carly loves to listen to post hardcore rock music, watch classic television sitcoms, and reads a variety of books. She also likes to challenge her writing by writing essays on various trending topics that draw her eye.&lt;/p&gt;&lt;p&gt;&lt;br&gt;&lt;/p&gt;&lt;p&gt;&lt;strong&gt;What They&#039;re Excited About Right Now&lt;/strong&gt;: The latest movies hitting the &quot;Big Five&quot; film festivals (especially Venice and Sundance). Anything A24 and Wes Anderson touches. Continuously making my mark through my writing and creating watchlists. &lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/N7exeZ3iQBSPka4V8mPomB-1280-80.jpg">
                                                            <media:credit><![CDATA[ABC/HBO Max]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[full house pilot final scene]]></media:description>                                                            <media:text><![CDATA[full house pilot final scene]]></media:text>
                                <media:title type="plain"><![CDATA[full house pilot final scene]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/N7exeZ3iQBSPka4V8mPomB-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>It was already mind-boggling to me when Candace Cameron Bure reminded us last year that the first episode of <a href="https://www.cinemablend.com/television/candace-cameron-bure-celebrates-38-years-full-house-dave-coulier-responded"><em>Full House</em> premiered over 38 years ago</a>. We were introduced to one of the most <a href="https://www.cinemablend.com/television/rating-sitcom-families-by-how-well-they-got-along">well-adjusted sitcom families</a> that came together to raise three little girls after the death of their mother. And oh mylanta, if you really want to feel old, Bure refreshed us that even the <em>final</em> episode of the classic sitcom is over 30 years old! </p><p>Back in 1995, <em>Full House</em> entertained its live studio audience one more time when the Tanners came together to help bring back Michelle’s memory after she'd falled off of her horse. If you’re curious how long ago that was, Candace Cameron Bure’s got an Instagram post all ready to jog your memory:</p><div class="instagram-embed"><blockquote class="instagram-media"  data-instgrm-version="6" style="width:99.375%; width:-webkit-calc(100% - 2px); width:calc(100% - 2px);"><p><a href="https://www.instagram.com/p/DYsYnoqgURy/" target="_blank">A post shared by Candace Cameron Bure (@candacecbure)</a></p><p>A photo posted by  on </p></blockquote></div><p>I love how even though Bure has been busying herself <a href="https://www.cinemablend.com/television/candace-cameron-bure-explains-why-she-left-hallmark-for-gaf">heading the Great American Family network</a>, she still finds time to throw back the series that started it all for her. It’s a great example of how the former Hallmark star may have had to say goodbye to <em>Full House,</em> but <em>Full House </em>will never say goodbye to her.</p><p>Not only am I feeling nostalgic seeing the promotional photos of the series, as well as the cast taking their last bow, but also Bure's throwback wardrobe. The T-shirt she’s wearing of the <a href="https://www.cinemablend.com/television/classic-tv-catchphrases-and-the-story-behind-them">classic show’s best catchphrases</a> or the “Oh Mylanta” tee of the Tanner House by Golden Gate Bridge made my day. Looking at these T-shirts is already making me hear in my head the <a href="https://www.cinemablend.com/television/retro-tv-theme-songs-that-still-slap">retro TV theme song that’s still catchy.</a></p><p>If you can believe it, the initially envisioned <a href="https://www.cinemablend.com/television/1596451/the-real-ending-to-full-house-according-to-creator-jeff-franklin">ending of <em>Full House</em></a> was quite differently from what was aired. After creator Jeff Franklin left the <a href="https://www.cinemablend.com/television/10-Greatest-TGIF-Comedies-All-Time-Ranked-120697.html">great TGIF comedy</a> after five seasons to focus on <em>Hangin’ with Mr. Cooper, </em>writers Marc Warren and Dennis Rinsler took over. Franklin said if he had it his way with the finale, he would have had the last episode throwback to the pilot. </p><p>Fortunately, Jeff Franklin got his wish when <a href="https://www.cinemablend.com/television/Full-House-Definitely-Coming-Back-Get-Details-71427.html">he got <em>Fuller House</em> on board with Netflix</a>. The series premiere definitely did a great job revisiting the original show’s themes of a family coming together in the wake of tragedy and ending with everyone joining in song, as the pilot did. Those wholesome, family vibes of both series will always touch the hearts of audiences as well as the cast who helped shape the series.  </p><p>It’s hard to believe that it’s been 31 years since <em>Full House</em>’s final episode aired. Through Candace Cameron Bure’s reminder, it’s a clear sign that the show’s legacy will forever live on and continue to connect generations of viewers for a lifetime. You can stream the ABC sitcom on your <a href="https://www.cinemablend.com/television/2570844/subscribing-to-hulu-the-price-whats-included-and-everything-else-to-know">Hulu subscription</a> and your <a href="https://www.cinemablend.com/news/2492773/how-to-best-use-disney-tips-to-get-the-most-out-of-the-streaming-service">Disney+ subscription</a>.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ Wait, David Spade Could Have Played Joey On Full House? ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/david-spade-could-have-played-joey-gladstone-dave-coulier-full-house</link>
                                                                            <description>
                            <![CDATA[ Where do I buy this alternate universe DVD? ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">LASmWsE6HLbZx6z6BFqkuU</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/cwZXNmwmbay3SbRhWHEFcY-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Wed, 20 May 2026 18:20:22 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Mack Rawden ]]></dc:creator>                                                                                                        <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Mack Rawden is the Editor-In-Chief of CinemaBlend. He first started working at the publication as a writer back in 2007 and has held various jobs at the site in the time since including Managing Editor, Pop Culture Editor and Staff Writer. He now splits his time between working on CinemaBlend’s user experience, helping to plan the site’s editorial direction and writing passionate articles about niche entertainment topics he’s into. He graduated from Indiana University with a degree in English (go Hoosiers!) and has been interviewed and quoted in a variety of publications including Digiday.&lt;/p&gt;&lt;p&gt;&lt;strong&gt;What He’s Into&lt;/strong&gt;: Mack is a professional wrestling fanatic, who enjoys Bobby Heenan’s commentary, Bret Hart’s in-ring work and an angry promo from The Miz. He loves a good case of the week mystery, particularly when it’s solved by Patrick Jane. He’s seen every episode of The Amazing Race, Top Chef and The Great British Bake-Off, among many reality competition shows. He watches more than 50 new release movies a year, yells at his TV during every single Chicago Bulls game and is still mad about what happened to Varys. His all-time favorite TV show is Freaks and Geeks. His all-time favorite movie is Clue. His all-time favorite book is Peter Pan, and most importantly, his all-time favorite snack is a hot english muffin with peanut butter and some chocolate chips sprinkled on top.&lt;/p&gt;&lt;p&gt;&lt;strong&gt;What He’s Excited About Right Now&lt;/strong&gt;: Chad Gable&amp;#39;s recent heel turn, Fallout&amp;#39;s exciting first season and catching up on all the non-US seasons of The Traitors.&lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/cwZXNmwmbay3SbRhWHEFcY-1280-80.jpg">
                                                            <media:credit><![CDATA[Paramount]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[David Spade in Tommy Boy]]></media:description>                                                            <media:text><![CDATA[David Spade in Tommy Boy]]></media:text>
                                <media:title type="plain"><![CDATA[David Spade in Tommy Boy]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/cwZXNmwmbay3SbRhWHEFcY-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>Oh Mylanta! I’m not normally the type of fan that second guesses what a movie or tv show would have been like had another actor been cast in a specific role, but as a superfan of both <em>Saturday Night Live</em> and <em>Full House</em>, I have to admit I’m spiraling right now. I just found out that a few years before Lorne Michaels brought him to Studio 8H, David Spade was called in to read for the part of Joey Gladstone. </p><p>Apparently Spade has mentioned his audition before, but I wasn’t aware of it until I listened to the comedian’s appearance on <a href="https://www.esquire.com/entertainment/movies/a71074991/david-spade-what-ive-learned/">Esquire’s What I’ve Learned</a> earlier today. Host Michael Sebastian asked Spade if it was true he almost played Joey, and I let out an audible, “Have Mercy!” The <em>Joe Dirt</em> star verified it happened and even gave some insight into his audition. Here’s a portion of his quote…</p><div><blockquote><p>That’s not a total lie. When I moved here, it was one of my first auditions when I had a little heat on me, and I read for Joey. I remember something about something (being) in the laundry basket, and I was trying to juggle the (clothes). I was like, ‘hey!’ I didn’t know what I was doing, but let’s just say I safely didn’t get that close.</p></blockquote></div><p>I love Spade, but it’s hard to imagine him being a fit on <em>Full House</em>. Dave Coulier, who got the Joey role, projects extreme sincerity, which is the hallmark of the show itself. It’s all about learning lessons and connecting as a family, whether you’re related by blood or just by love. </p><p>Spade, on the other hand, is all about insincerity. He’s best when he’s sliding in little comments and second-guessing everything going on around him. It’s hard for me to imagine how any of it would have blended together, except I’m positive his scenes with <a href="https://www.cinemablend.com/streaming-news/andrea-barber-recalls-fuller-house-detail-she-didnt-want-in-the-show-fans">noted weirdo Kimmy Gibbler</a> would have been electric.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="9AVYW7kiPzXLUvhbuieSyJ" name="JoeyGladstone" alt="Joey does ventriloquism on Full House." src="https://cdn.mos.cms.futurecdn.net/9AVYW7kiPzXLUvhbuieSyJ.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class="inline"></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney/ ABC)</span></figcaption></figure><p>We have no idea if producers ever seriously considered him, but he said he knows he definitely was close to landing something on <em>In The Heat Of The Night</em>. That’s not really a show that’s talked about a ton anymore, but it was a police procedural that ran from 1988 to 1995. Perhaps more notably, it was Carroll O’Connor’s follow-up to <em>All In The Family</em>/ <em>Archie Bunker’s Place</em>. Had Spade been cast, he likely never would have <a href="https://www.cinemablend.com/television/david-spade-recalls-tension-rob-schneider-snl-how-they-settled-feud">had that amazing run on <em>SNL</em></a> (<a href="https://www.cinemablend.com/television/2548912/why-david-spade-had-trouble-adjusting-from-snl-to-starring-in-just-shoot-me">or <em>Just Shoot Me</em></a>) and may have seen his career go down an entirely separate path since the show had a much more serious tone.</p><p><em>Full House</em> ran for eight seasons and unlike <em>In The Heat Of The Night</em>, <a href="https://www.cinemablend.com/television/full-houses-jodie-sweetin-andrea-barber-weighed-in-another-spinoff-challenge-making-it">remains very culturally relevant</a>. Reruns of the sitcom were broadcast very consistently for decades, and more recently, Netflix even gave us five seasons of <a href="https://www.cinemablend.com/television/2547793/fuller-house-all-the-biggest-full-house-callbacks-from-the-final-netflix-episodes">a spinoff following the next generation called <em>Fuller House</em></a>. I’ve seen every single episode of both shows. I wouldn’t change a thing about the cast, but I would pay more money than I’d care to share for an alternate universe DVD set of the show featuring Spade exchanging, “You got it, dudes” with the Olsen Twins. </p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ I Would Have Thought Jodie Sweetin Was Making Bank From Full House, But What's Really Happening? ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/i-thought-jodie-sweetin-making-bank-from-full-house-whats-really-happening</link>
                                                                            <description>
                            <![CDATA[ Oh my lanta! ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">5qrbRPNhqdjjmEK6FTYzpJ</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/j5XNspjR9WFjMoj5tkVtLh-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Tue, 05 May 2026 12:30:06 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Heidi Venable ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/w7HQ9MvRSDd7diNpTmruW9.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Heidi Venable is a Content Producer for CinemaBlend. She started freelancing for the site in 2020 and officially came on board in 2021. Her job entails writing news stories and TV reactions from some of her favorite prime-time shows like Grey&#039;s Anatomy and The Bachelor. She graduated from Louisiana Tech University with a degree in Journalism and worked in the newspaper industry for almost two decades in multiple roles including Sports Editor, Page Designer and Online Editor.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Into&lt;/strong&gt;: Heidi grew up in the 1990s, and her tastes strongly reflect that. She can (and does) quote Friends constantly, enjoys a good West Wing binge, thinks Can&#039;t Hardly Wait was the most influential movie of her life and finds solace in 311 concerts. On Sundays during football season, she can be found cheering on the New Orleans Saints with her husband and two daughters. Who Dat! She loves to read but usually settles for a pop culture podcast, and thinks the best weekends are spent cooking and playing cards with friends and family, preferably with some UFC fights or other sporting event on TV.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Excited About Right Now&lt;/strong&gt;: Football season, Pumpkin Spice Lattes and everything related to fall and cooler weather. The Game of Roses podcast and all things The Bachelor, and new episodes of Grey&#039;s Anatomy, Love Is Blind, The Voice, OMITB and more.&amp;nbsp;&lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/j5XNspjR9WFjMoj5tkVtLh-1280-80.jpg">
                                                            <media:credit><![CDATA[Michael Yarish/Netflix]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Jodie Sweetin as Stephanie on Fuller House.]]></media:description>                                                            <media:text><![CDATA[Jodie Sweetin as Stephanie on Fuller House.]]></media:text>
                                <media:title type="plain"><![CDATA[Jodie Sweetin as Stephanie on Fuller House.]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/j5XNspjR9WFjMoj5tkVtLh-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>There’s no question that playing Stephanie Tanner on <em>Full House</em> was the role of a lifetime for Jodie Sweetin. The sitcom was a hit for eight seasons on ABC in the late ‘80s and early ‘90s and lived on in syndication for years after that — not to mention the fact that Sweetin got to reprise the character for the 2016 spinoff <em>Fuller House</em>. The actress knows <a href="https://www.cinemablend.com/television/full-house-jodie-sweetin-coming-terms-being-known-stephanie-tanner-forever">she’ll be Stephanie Tanner forever</a>, so one would think she makes quite a bit of money from that, right? Well, not so fast.</p><p>Honestly, with the way <em>Full House</em> played constantly on TV when I was growing up and has only continued to grow new fans over the decades, I picture Jodie Sweetin swimming Scrooge McDuck-style through piles and piles of cash. She painted a different picture, however, when asked about it on <a href="https://www.youtube.com/watch?v=KHIhTDw66tA&t=5s"><em>The McBride Rewind</em> podcast</a><em>, </em>saying the <em>Full House</em> well has dried up:</p><div><blockquote><p>I got a one-cent check the other day. No, there's no syndication anymore, because it's all on streaming. Who gets paid for that? Nobody gets paid for that. </p></blockquote></div><p>How rude! The fact that the talent doesn’t benefit from fans streaming <em>Full House</em> with a <a href="https://www.cinemablend.com/television/2570844/subscribing-to-hulu-the-price-whats-included-and-everything-else-to-know">Hulu subscription</a> isn’t something that viewers typically give much thought to, but streaming residuals were definitely a hot topic during the SAG-AFTRA strikes in 2023. <em>Abbott Elementary</em>’s <a href="https://www.cinemablend.com/television/abbott-elementary-william-stanford-davis-shows-residuals-check-after-deleting-f-bombs-video">William Stanford Davis showed off his 5-cent check</a> at the time, as <a href="https://www.cinemablend.com/television/ellen-pompeo-claps-back-netflix-actors-residuals-mandy-moore-this-is-us-checks">Mandy Moore opened up about making 81 cents</a> for <em>This Is Us</em>.</p><p>Jodie Sweetin says people don’t realize how small that residual income is, or how inconsistent it was even when the dollar amount was higher. She said:</p><div><blockquote><p>People [are] like, ‘Oh, but you get the residuals.’ You're like, ‘Well, I mean, maybe like the first run of syndication, like when it, you know.' Sure, in my 20s, there would be money, but not reliable. You don't know how much it's going to be or how often they're going to run the show. So, sometimes you're like, 'Oh, cool. That was nice.' And then sometimes you're like, 'All right, well, there's a nice dinner out.’</p></blockquote></div><p>Jodie Sweetin, it turns out, is more like the rest of us than we may have thought, despite growing up in front of the cameras on a hit TV show. She continued:</p><div><blockquote><p>You just kind of don't know. So, it's not something you can rely on. Like I always say, people think I live some extravagant life. I'm like, 'Honey, I drive my 2023 used Hyundai Sonata that I love. I rent my house. I have credit cards that are maxed out.' I live a normal life. And, yeah, there are moments when you're like, 'This is going well,' and there are times when you're like, 'I need a day job.'</p></blockquote></div><p>Yikes. I honestly would have thought that role set her up for life. It’s disappointing to hear that not everybody has the same experience as the <em>Friends</em> stars who reportedly <a href="https://www.cinemablend.com/television/2485761/how-much-does-the-cast-of-friends-get-paid-from-royalties">continue to make $20 million in residuals</a> each year, especially when shows like <em>Full House</em> remain popular titles on streaming. </p><p>If you want to catch up with Stephanie Tanner, you can find <em>Full House</em> on Hulu or stream <em>Fuller House</em> with a <a href="https://www.cinemablend.com/streaming-news/netflix-subscription-the-plans-the-price-and-whats-included">Netflix subscription</a>.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ I've Been A Full House Fan For Years, But I Had No Idea There Was 'Tension' Between John Stamos, Bob Saget And Dave Coulier Early On ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/full-house-fan-tension-john-stamos-bob-saget-dave-coulier-early-on</link>
                                                                            <description>
                            <![CDATA[ Just like any other family. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">e3sbS88ArVByJ9iMB8bwH3</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/X7FkXGmqXLMCAFMH4GnxwG-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Wed, 29 Apr 2026 14:57:16 +0000</pubDate>                                                                                                                                <updated>Thu, 30 Apr 2026 21:49:58 +0000</updated>
                                                                                                                                            <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Megan Behnke ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/FBUR6A5F9FTHQpVfjSuYpL.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Megan Behnke has been a Freelance TV News Writer at CinemaBlend since 2021. She has worked at multiple entertainment outlets, including as a Writer and Editor at Nerds and Beyond, TV and Movie News Writer at CBR, and a Freelance Writer at TV Fanatic, writing about topics she&#039;s passionate about like pop culture. She graduated from the University of Wisconsin Oshkosh with a degree in Multimedia Journalism in 2020, writing for the school’s newspaper during her time there. Her expertise in entertainment is mainly in television, but she has written about movies, music, and local events as well.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What They&#039;re Into&lt;/strong&gt;: Megan specializes in television writing, particularly procedurals. 9-1-1 and the Chicago Franchise are currently her favorites, where she can be found obsessively watching the latest episode or coming up with theories. She also loves to listen to music, with Taylor Swift being on the top of her playlist. She isn’t a huge sports person but will occasionally root for the Green Bay Packers, Milwaukee Brewers, and Wisconsin Badgers. As for movies, it’s hard to pick a favorite, but the Marvel Cinematic Universe reigns as her favorite franchise. She used to be a book nerd in grade school, with her favorite genre being fantasy or YA. Her favorite snack is sour cream and onion Pringles, while pizza is her all-time favorite food.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What They&#039;re Excited About Right Now&lt;/strong&gt;: Manifest Season 4 finally coming to Netflix, One Chicago, and Taylor Swift’s upcoming Midnights album, which will be on repeat.&lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/X7FkXGmqXLMCAFMH4GnxwG-1280-80.jpg">
                                                            <media:credit><![CDATA[Max]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[John Stamos, Bob Saget and Dave Coulier as Jesse, Danny and Joey on Full House&#039;s Season 1 episode &quot;Sea Cruise.&quot;]]></media:description>                                                            <media:text><![CDATA[John Stamos, Bob Saget and Dave Coulier as Jesse, Danny and Joey on Full House&#039;s Season 1 episode &quot;Sea Cruise.&quot;]]></media:text>
                                <media:title type="plain"><![CDATA[John Stamos, Bob Saget and Dave Coulier as Jesse, Danny and Joey on Full House&#039;s Season 1 episode &quot;Sea Cruise.&quot;]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/X7FkXGmqXLMCAFMH4GnxwG-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <iframe src="https://content.jwplatform.com/players/upWk92Wi.html" id="upWk92Wi" title="‘I Can’t Imagine The BS.’ Jodie Sweetin Talks Seeing The Olsens At Bob Saget’s Funeral (And Where’s She’s At On Candace Cameron Bure)" width="600" height="338" frameborder="0" scrolling="auto" allowfullscreen></iframe><p><em>Full House </em>will be having its 40<sup>th</sup> anniversary next year, which is crazy to think about. But the series remains a favorite among many fans, myself included. Thanks to reruns on Nick at Nite, I have been a fan of the TGIF sitcom for years. It's one of the <a href="https://www.cinemablend.com/television/100-best-tv-sitcoms-of-all-time-ranked">best sitcoms of all time</a>, and one of the best things about the show is that almost everyone on the cast remains close to this day. That's why I was so surprised to hear there was “tension” between John Stamos, the <a href="https://www.cinemablend.com/television/full-house-star-bob-saget-is-dead-at-65">late, great Bob Saget</a>, and Dave Coulier early on.</p><p>One of the reasons why <em>Full House </em>did so well and why it ran for eight seasons is because of the chemistry between the cast. The show was about a family, and everyone was practically a family off-screen as much as on-screen. Stephanie Tanner actress Jodie Sweetin revealed on the podcast <a href="https://www.youtube.com/watch?v=KHIhTDw66tA"><em>The McBride Rewind</em></a><em> </em>that everyone was very close, but there was something a little different when it came to the dynamic between Stamos, Saget, and Coulier that was different from Jesse, Danny, and Joey:</p><div><blockquote><p>All of us were very close. And even Ashley and Mary-Kate. It was a family. It was a real family. And like, Bob and John, well, John, when he first came, had just come off General Hospital, and he was like An Actor. And Bob and Dave just fucked around all the time. They're just comedians, and that's it.</p></blockquote></div><p>Going from a soap opera like <em>General Hospital </em>to a full-blown family sitcom like <em>Full House </em><a href="https://www.cinemablend.com/television/john-stamos-nervous-full-houses-future-filming-pilot-olsen-twins-fired">couldn’t have been easy for Stamos</a>, and he’s opened up in the past about <a href="https://www.cinemablend.com/television/john-stamos-recalls-working-with-bob-saget-full-house-and-why-star-was-frustrated-early-on">how frustrating the show's early years were</a>. While things definitely got easier as the show went on, and the writers even took notice of his quick friendship with Coulier. Sweetin admitted that, at least during the first season, there was some tension when it came to professionalism:</p><div><blockquote><p>There was tension at first with John wanting to get the job done, and Bob and Dave are screwing around. I don't know when it happened. At some point by the second season, it just started to click for them. John kind of let go... and then they were brothers.</p></blockquote></div><p>It’s hard to imagine how different things would have been, not only with the show but with the cast, had Stamos not let his guard down and really started having fun on the set. It’s also because of him letting go that the dynamic between Jesse and Joey and their partnership really became core to the show, as well as the dynamic between the two of them and Danny. And I am so glad that the tension got resolved by the second season, because who knows what would have happened.</p><p>While that tension has obviously been resolved for years, there has been some new tension coming out in recent years between Sweetin and on-screen sister Candace Cameron Bure. The two, who have had a public fallout following <a href="https://www.cinemablend.com/television/ex-hallmark-star-hilarie-burton-went-off-on-candace-cameron-bure-after-gaf-star-said-new-movies-will-feature-traditional-marriages">Bure’s “traditional marriage” comments</a>, have seemingly buried the hatchet on a few different occasions. Sweetin previously spoke out about their differing viewpoints, admitting <a href="https://www.cinemablend.com/television/full-house-jodie-sweetin-never-actually-feuding-candace-cameron-bure-traditional-marriage-beliefs-very-different-worlds">they weren’t ever really feuding</a>, but knows that they don’t have the same beliefs.</p><p>Like any family, though, nothing is ever perfect, and there will be fights. All that really matters is that, for the most part, the family that fans saw on-screen was true off-screen, albeit a little differently. But don’t even get me started on <a href="https://www.cinemablend.com/television/full-houses-john-stamos-opens-up-about-getting-olsen-twins-temporarily-fired-in-place-of-unattractive-redheads">Stamos getting the Olsen Twins fired</a> when the show was first starting out. </p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ People Always Ask Jodie Sweetin About Mary-Kate And Ashley Olsen: 'Oh, Do You Guys Not Talk?’ ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/people-ask-jodie-sweetin-about-mary-kate-ashley-olsen-speaking-present-day</link>
                                                                            <description>
                            <![CDATA[ Where does she stand with her TV sisters? ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">k5RXtcXLLEkBSWuwu4kUDo</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/L6N7zZLKcgv6idSHrQXAoe-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Mon, 27 Apr 2026 14:17:39 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Heidi Venable ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/w7HQ9MvRSDd7diNpTmruW9.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Heidi Venable is a Content Producer for CinemaBlend. She started freelancing for the site in 2020 and officially came on board in 2021. Her job entails writing news stories and TV reactions from some of her favorite prime-time shows like Grey&#039;s Anatomy and The Bachelor. She graduated from Louisiana Tech University with a degree in Journalism and worked in the newspaper industry for almost two decades in multiple roles including Sports Editor, Page Designer and Online Editor.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Into&lt;/strong&gt;: Heidi grew up in the 1990s, and her tastes strongly reflect that. She can (and does) quote Friends constantly, enjoys a good West Wing binge, thinks Can&#039;t Hardly Wait was the most influential movie of her life and finds solace in 311 concerts. On Sundays during football season, she can be found cheering on the New Orleans Saints with her husband and two daughters. Who Dat! She loves to read but usually settles for a pop culture podcast, and thinks the best weekends are spent cooking and playing cards with friends and family, preferably with some UFC fights or other sporting event on TV.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Excited About Right Now&lt;/strong&gt;: Football season, Pumpkin Spice Lattes and everything related to fall and cooler weather. The Game of Roses podcast and all things The Bachelor, and new episodes of Grey&#039;s Anatomy, Love Is Blind, The Voice, OMITB and more.&amp;nbsp;&lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/L6N7zZLKcgv6idSHrQXAoe-1280-80.jpg">
                                                            <media:credit><![CDATA[Warner Bros.]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Jodie Sweetin and one of the Olsen twins on Full House.]]></media:description>                                                            <media:text><![CDATA[Jodie Sweetin and one of the Olsen twins on Full House.]]></media:text>
                                <media:title type="plain"><![CDATA[Jodie Sweetin and one of the Olsen twins on Full House.]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/L6N7zZLKcgv6idSHrQXAoe-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>It’s no surprise that Jodie Sweetin is constantly asked about <em>Full House</em>. The family-friendly sitcom premiered nearly 40 years ago (I know!) and has continued to attract new generations of fans. With the members of the <a href="https://www.cinemablend.com/television/rating-sitcom-families-by-how-well-they-got-along">fictional family remaining so close</a>, of course people want to know everything about those Tanner dynamics. Sweetin’s relationship with Candace Cameron Bure remains a big talking point <a href="https://www.cinemablend.com/television/full-house-jodie-sweetin-never-actually-feuding-candace-cameron-bure-traditional-marriage-beliefs-very-different-worlds">years after their alleged feud</a>, but fans also constantly ask her about Mary-Kate and Ashley Olsen.</p><p>Jodie Sweetin has admitted that she was <a href="https://www.cinemablend.com/television/why-jodie-sweetin-closer-to-mary-kate-ashley-olsen-than-candace-cameron-bure-during-full-house">closer to the Olsen twins</a> — who played Stephanie’s younger sister Michelle on the set of <em>Full House</em> — than she was to Candace Cameron Bure, who played older sister DJ. However, while the two older <a href="https://www.cinemablend.com/television/see-full-houses-candace-cameron-bure-jodie-sweetin-reunite-90s-con-reported-feud">Tanner sisters will reunite</a> every so often, Sweetin says she doesn’t keep in touch with Mary-Kate and Ashley. She told <a href="https://www.youtube.com/watch?v=KHIhTDw66tA"><em>The McBride Rewind</em> podcast</a>, though that hasn't stopped people from asking her about it: </p><div><blockquote><p>They kind of, I think, after Full House and growing up and everything, they’ve had an extremely different trajectory than any of the rest of us. People also say, 'Oh do you guys not talk? Is it bad?' No! They were 8 years old when the show finished. We weren't as close as we were. ... It wasn’t like there was bad blood between any of us, but they moved to New York, got married, and had a fashion empire.</p></blockquote></div><p>Sweetin has pointed out before that all of Ashley and Mary-Kate Olsen’s memories of <em>Full House</em> <a href="https://www.cinemablend.com/streaming-news/full-houses-jodie-sweetin-shared-the-best-reasoning-for-why-the-olsen-twins-didnt-return-for-netflixs-fuller-house">happened when they were eight years old</a> or younger. But for her, Candace Cameron Bure and Andrea Barber (who played Kimmy Gibbler), the show’s eight seasons fell during really formative years of their lives. Sweetin continued:</p><div><blockquote><p>If you knew somebody the first eight years of your life, and then you sort of drifted away, how many people do you still talk to from that? It’s not like it’s a bad thing. They don't have as much recollection as I do. It was my formative years. I was 5-13... It was impactful. It was all I ever knew.</p></blockquote></div><p>There’s also the fact that <a href="https://www.cinemablend.com/television/full-house-jodie-sweetin-coming-terms-being-known-stephanie-tanner-forever">Jodie Sweetin will always be known as Stephanie Tanner</a>, and for much of the rest of the <em>Full House</em> cast, as well, the San Francisco sitcom with the <a href="https://www.cinemablend.com/television/retro-tv-theme-songs-that-still-slap">theme song that still slaps</a> was a career-defining role. That’s not the case for the Olsen twins. Sweetin said:</p><div><blockquote><p>They did it and then maybe had a few years of remembering it and then went on and did a whole host of other things in their life. Those first eight years get pushed off. We're not as close anymore, and that's OK.</p></blockquote></div><div  class="fancy-box"><div class="fancy_box-title">MORE FULL HOUSE</div><div class="fancy_box_body"><figure class="van-image-figure "  ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="imrLVWC9ZV6Dwr9n3FjK7P" name="olsen twins.jpg" caption="" alt="olsen twins in double, double, toil and trouble" src="https://cdn.mos.cms.futurecdn.net/imrLVWC9ZV6Dwr9n3FjK7P.jpg" mos="" link="" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pinterest-pin-exclude"></p></div></div><figcaption itemprop="caption description" class=""><span class="credit" itemprop="copyrightHolder">(Image credit: Hulu)</span></figcaption></figure><p class="fancy-box__body-text"><ul><li><a data-analytics-id="inline-link" href="https://www.cinemablend.com/television/full-house-producers-had-preferred-olsen-twin-to-work-with-mary-kate-ashley"><strong>Full House producers preferred working with one Olsen twin over the other.</strong></a><strong></strong></li><li><a data-analytics-id="inline-link" href="https://www.cinemablend.com/television/jodie-sweetin-candid-being-very-different-from-candace-cameron-bure-faith-based-backlash"><strong>Jodie Sweetin says she's "very different" from Candace Cameron Bure amidst feud.</strong></a><strong></strong></li><li><a data-analytics-id="inline-link" href="https://www.cinemablend.com/television/john-stamos-seriously-went-offlori-loughlin-ex-mossimo-guinolli"><strong>John Stamos absolutely went off in rant about Lori Loughlin’s ex-husband.</strong></a></li></ul></p></div></div><p>Jodie Sweetin has a lot of empathy for the way they spent their childhood working, and she said she “<a href="https://www.cinemablend.com/television/jodie-sweetin-talks-seeing-olsens-bob-saget-funeral-reunion-candace-cameron-bure-history-full-house">can’t imagine the BS</a>” they’ve had to go through. She was able to catch up with the twins a few years ago when <a href="https://www.cinemablend.com/television/mary-kate-and-ashley-olsen-make-rare-public-statement-in-tribute-to-bob-saget-after-his-death">Mary-Kate and Ashley Olsen paid tribute to Bob Saget</a> at his funeral, alongside the rest of their <em>Full House</em> family.</p><p>It’s completely understandable that the Olsen twins and Jodie Sweetin have grown in different directions over the years, and I love that the Stephanie Tanner actress has the grace to know that’s OK.</p><p>You can see the Tanner family at full strength by streaming all eight seasons of <em>Full House</em> with a <a href="https://www.cinemablend.com/television/2570844/subscribing-to-hulu-the-price-whats-included-and-everything-else-to-know">Hulu subscription</a>. </p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ Topanga, Winnie Cooper and Kimmy Gibbler Made A Throwback Video Together That's Wrecking Instagram ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/danielle-fishel-topanga-danica-mckellar-winnie-cooper-andrea-barber-kimmy-gibbler-throwback-video-wrecking-instagram</link>
                                                                            <description>
                            <![CDATA[ Hubba to the hubba. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">K8rg8s4CqCUJdBheuwiFTb</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/pdGvoLToajE67WMF8kiZTW-1280-80.png" type="image/png" length="0"></enclosure>
                                                                        <pubDate>Tue, 07 Apr 2026 16:50:06 +0000</pubDate>                                                                                                                                <updated>Wed, 08 Apr 2026 20:02:59 +0000</updated>
                                                                                                                                            <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Nick Venable ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/TzeQjfZT5cKqHRsEqudtqT.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Nick Venable is an Assistant Managing Editor, and the TV Editor. His humble origin story with CinemaBlend began all the way back in the pre-streaming era, circa 2009, as a freelancing DVD reviewer and TV recapper. After rising up through the ranks covering Movies, Nick leapfrogged over to the small screen to cover more and more television news and interviews, eventually taking over the section for the current era. Born in Louisiana and currently living in Texas — Who Dat Nation over America’s Team all day, all night — Nick spent several years in the hospitality industry, and also worked as a 911 operator. And if you ever happened to hear his music or read his comics/short stories, you have his sympathy. His love for his wife and daughters is almost equaled by his love of gasp-for-breath laughter and gasp-for-breath horror. A lifetime spent in the vicinity of a television screen led to his current dream job, as well as his knowledge of too many TV themes and ad jingles.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Into&lt;/strong&gt;: Nick is one of those people who won’t necessarily insert a Monty Python reference into every conversation, but is still mentally equipped to do so. Beyond such appreciation for surreal UK comedy, Nick also indulges in as much horror splendor as possible, from Stephen King novels to James Tynion IV comics to Freddy Krueger one-liners to all things Mike Flanagan. Throw in a dash of NFL, some 311 and Weird Al, fried crawfish poboys, bourbon, ‘90s-era pro wrestling, crossword puzzles and mystery-driven video games, and baby, you got a stew going. (Nick will insert an Arrested Development reference into every conversation, if possible.)&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Excited About&lt;/strong&gt;: Anything Jeff Lemire, Tom King and W. Maxwell Prince think of, ever. More of Kelly Reilly’s deliriously fierce performances on Yellowstone. HBO’s The Last of Us. Clone High’s return. Colin Farrell’s Penguin being in every movie/TV show/breakfast cereal.&lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/png" url="https://cdn.mos.cms.futurecdn.net/pdGvoLToajE67WMF8kiZTW-1280-80.png">
                                                            <media:credit><![CDATA[Julianne Hough, E!, NBCU]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Side by side: Danielle Fishel interviewed by Julianne Hough, Andrea Barber in colorful button-up talking about grief on E! News, Danica McKellar holding hands together looking into camera on TODAY]]></media:description>                                                            <media:text><![CDATA[Side by side: Danielle Fishel interviewed by Julianne Hough, Andrea Barber in colorful button-up talking about grief on E! News, Danica McKellar holding hands together looking into camera on TODAY]]></media:text>
                                <media:title type="plain"><![CDATA[Side by side: Danielle Fishel interviewed by Julianne Hough, Andrea Barber in colorful button-up talking about grief on E! News, Danica McKellar holding hands together looking into camera on TODAY]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/pdGvoLToajE67WMF8kiZTW-1280-80.png" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>Just because we’re in the midst of the <a href="https://www.cinemablend.com/television/2026-tv-premiere-date-schedule-network-streaming-series">2026 TV schedule</a> doesn’t mean we can’t <em>also</em> be in the middle of ‘90s nostalgia, from <a href="https://www.cinemablend.com/television/lisa-kudrows-the-comeback-got-meta-with-friends-reference-two-hbo-valerie">Lisa Kudrow making <em>Friends</em> references on <em>The Comeback</em></a> to <a href="https://www.cinemablend.com/television/ben-affleck-full-dunkin-super-bowl-ad-includes-90s-sitcom-theme">Ben Affleck’s Super Bowl ad</a> to this week’s <a href="https://www.cinemablend.com/streaming-news/animorphs-author-shares-concerns-about-tv-adaptation-one-thing-i-desperately-want-fan-90s-books">news about that <em>Animorphs</em> reboot</a>. Over on <em>American Idol</em>, the judges and contestants celebrated the era with a ‘90s Time Warp episode, leading to a social media-crushing post from a trio of sitcom queens led by <em>Boy Meets World</em> vet Danielle Fishel (who also hosts <em>Idol</em>'s official podcast). </p><p>No stranger to leaning all the way back into ‘90s culture (for better and worse) in her co-created podcast <em>Pod Meets World</em>, Fishel teamed up with <em>Full House</em> and <em>Fuller House</em>’s Andrea Barber and <em>The Wonder Years</em>’ Danica McKellar to craft a ‘90s-infused post that sent Instagram (and perhaps yours truly) into a throwback, puppy-lovey tizzy. Check out the video below, which is set to the decade-defining tune of The Goo Goo Dolls’ “Iris.” </p><div class="instagram-embed"><blockquote class="instagram-media"  data-instgrm-version="6" style="width:99.375%; width:-webkit-calc(100% - 2px); width:calc(100% - 2px);"><p><a href="https://www.instagram.com/p/DW0BKprCXju/" target="_blank">A post shared by Danielle Fishel Karp (@daniellefishel)</a></p><p>A photo posted by  on </p></blockquote></div><p>The comedic threesome tipped their metaphorical hats to the ‘90s roles that turned them each into eternal TV stars, and it’s amazing to see instant evidence of just how much each of them h as changed over the past 30 years or so, while also still essentially looking the exact same. I probably should have reached out to ask for beauty tips back in 1996, but that ship has likely sailed. </p><div  class="fancy-box"><div class="fancy_box-title">More On '90s Throwbacks</div><div class="fancy_box_body"><p class="fancy-box__body-text"><a data-analytics-id="inline-link" href="https://www.cinemablend.com/television/candace-cameron-bure-shared-throwback-post-jennifer-aniston-danica-mckellar-other-sitcom-stars-in-90s-tv-movie"><strong>Candace Cameron Bure Shared Throwback Post With Jennifer Aniston, Danica McKellar And Tons Of Other Sitcom Stars In ‘90s TV Movie</strong></a></p></div></div><p>I gotta say, for all the '90s details seen in those photos, I think my favorite decade-specific detail is the see-through phone that's sitting on the table in front of the actresses. It's quite bizarre to see someone's cell phone lying next to it, too. </p><p>Understandably, the post garnered a slew of likes and shares, with several other celebs chiming in, including Barber's <em>Full House</em> chum Candace Cameron Bure, and the offiicial Goo Goo Dolls profile. </p><ul><li><strong>CANDACE CAMERON BURE:</strong> Love it</li><li><strong>HOLLY ROBINSON PEETE:</strong> Awesome</li><li><strong>DAMON WAYANS JR:</strong> Oh come on 🥹😍🥰</li><li><strong>MIKE RUGA:</strong> This trio tho 🔥🔥🔥</li><li><strong>THE GOO GOO DOLLS:</strong> 💜💜💜</li></ul><p>So many non-celeb comments as well, with a lion's of the responses being about childhood crushes that may or may not have dissipated over time. Which is to say, a lot of hornballs, both men and women. (Though mostly men.) Fishel has spoken about being perceived as a sex symbol as a teen, and the <a href="https://www.cinemablend.com/television/boy-meets-world-danielle-fishel-feeling-like-her-body-a-problem-filming">body issues that plagued her</a>, but given that most of the comments are more sweet and innocent than salacious, hopefully they're received well. </p><p>I just want to shout out this comment for feeling as if it was removed directly from my brain and transcribed by Instagram. </p><ul><li>If you added Kelly Kapowski with Topenga and Winnie Cooper, would have been the Trifecta! - @jake005</li></ul><p>Danielle Fishel later shared a post more directly tied to <em>American Idol</em>, in which she and the judges mouthed the words to dialogue from Ryan Murphy's horror comedy series <em>Scream Queens</em>. It's not exactly a '90s callbak, but the show did co-star <em>Full House</em>'s John Stamos, so it counts. </p><div class="instagram-embed"><blockquote class="instagram-media"  data-instgrm-version="6" style="width:99.375%; width:-webkit-calc(100% - 2px); width:calc(100% - 2px);"><p><a href="https://www.instagram.com/p/DW0ZD1pkV_R/" target="_blank">A post shared by Danielle Fishel Karp (@daniellefishel)</a></p><p>A photo posted by  on </p></blockquote></div><p>All three of the actresses seen above are maintaining their busy careers. Andrea Barber, for example, is currently hosting the <em>Full House</em> rewatch podcast <em>How Rude, Tanneritos</em> alongside former co-star Jodie Sweetin, with the latest episode covering Season 6, Episode 14. </p><p>Fresh off of her <em>Dancing with the Stars</em> season, Fishel and her former co-stars Will Friedle and Rider Strong remain busy with <em>Pod Meets World</em>. And <a href="https://www.cinemablend.com/television/danica-mckellar-celebrated-50-bikini-birthday-plunge-looks-chilly">Danica McKellar, who turned 50 last year</a>, recently <a href="https://www.cinemablend.com/television/sweet-way-danica-mckellar-celebrated-the-wonder-years-38th-anniversary">celebrated the 38th anniversary of <em>The Wonders Years</em> premiere</a>, and has kept busy in recent years starring in Christmas movies for Hallmark and Great American Family.</p><p>Alright now, ABC, how's about bringing TGIF back for a night of sitcom reunion specials?</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ 'It Was Weird.' Boy Meets World Stars Seemingly Confirm Those Food Training Rumors About Full House’s Mary-Kate And Ashley Olsen ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/boy-meets-world-stars-seemingly-confirm-food-training-rumors-full-house-mary-kate-ashley-olsen</link>
                                                                            <description>
                            <![CDATA[ Here's what they saw back in the '90s. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">PcCF5KdvZ4LeCGGQpCyqG8</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/GfL6bLZ3FEEbcMoDQGU3EJ-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Wed, 01 Apr 2026 12:27:46 +0000</pubDate>                                                                                                                                <updated>Wed, 01 Apr 2026 16:48:53 +0000</updated>
                                                                                                                                            <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Jessica Rawden ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/gNi5ipvqyWREFVbs7Ehzx9.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background:&lt;/strong&gt; Jessica Rawden is Managing Editor at CinemaBlend. She’s been kicking out news stories at CinemaBlend since 2007 and joined the full-time staff in 2014. She oversees news content, hiring and training for the site, and her areas of expertise include theme parks, rom-coms, Hallmark (particularly Christmas movie season), reality TV, celebrity interviews and primetime. She loves a good animated movie.&amp;nbsp;&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;Jessica has a Masters in Library Science degree from Indiana University, and used to be found behind a reference desk most definitely not shushing people. She now uses those skills in researching and tracking down information in very different ways.&amp;nbsp;&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She’s Into&lt;/strong&gt;: A former soccer player and recent tennis addict, Jessica also enjoys running, both of the distance and sprint variety. When not at the movie theater or in a theme park, her other free time is spent in book clubs, hiking, drinking wine, binge-watching, keeping tabs on celebrity fashion and riding rollercoasters. Has a serious Hallmark habit and an even bigger record-buying habit. Will bake for compliments.&amp;nbsp;&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She’s Excited About Right Now&lt;/strong&gt;: &amp;nbsp;Hallmark Christmas movie season. Wearing socks to bed. &amp;nbsp;&amp;nbsp;&amp;nbsp;&amp;nbsp;&amp;nbsp;&lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/GfL6bLZ3FEEbcMoDQGU3EJ-1280-80.jpg">
                                                            <media:credit><![CDATA[ABC ]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Side-by-side screenshots of Rider Strong, Will Friedle and Trina McGee looking scared in a school doorway and The Olsen twins and Dave Coulier looking scared with mouths open on Full House.]]></media:description>                                                            <media:text><![CDATA[Side-by-side screenshots of Rider Strong, Will Friedle and Trina McGee looking scared in a school doorway and The Olsen twins and Dave Coulier looking scared with mouths open on Full House.]]></media:text>
                                <media:title type="plain"><![CDATA[Side-by-side screenshots of Rider Strong, Will Friedle and Trina McGee looking scared in a school doorway and The Olsen twins and Dave Coulier looking scared with mouths open on Full House.]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/GfL6bLZ3FEEbcMoDQGU3EJ-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <iframe src="https://content.jwplatform.com/players/iPycKULW.html" id="iPycKULW" title="It Was Weird.' 'Boy Meets World' Stars Seemingly Confirm Those Food Training Rumors About Full House’s Mary-Kate And Ashley Olsen" width="600" height="338" frameborder="0" scrolling="auto" allowfullscreen></iframe><p>There’s a lot that has been written about Mary-Kate and Ashley Olsen’s time on <em>Full House</em>, which feels a bit wild given the series ended when the two girls were like eight, and they <a href="https://www.cinemablend.com/television/We-Finally-Know-Why-Olsen-Twins-Aren-t-Fuller-House-120657.html"><u>didn’t return for the </u><u><em>Fuller House</em></u><u> spinoff</u></a> decades later. However, they remained in the public eye for a series of popular movies for several years after that, and later went on to be fashion icons and <a href="https://www.cinemablend.com/television/former-employee-what-working-with-mary-kate-and-ashley-olsen-really-like"><u>businesswomen with The Row</u></a> (and the now-defunct Elizabeth & James). So, there’s still a fascination with them as socialites despite their trajectory in Hollywood, and also I think because they became so famous so young. </p><p>Which is where the food piece comes in. For years, there have been rumors Mary-Kate and Ashley Olsen were motivated by food, and during a recent episode of “<a href="https://open.spotify.com/show/11BA5Y1PBaleEjJAFAP8MG"><u>Pod Meets World</u></a>” former <em>Boy Meets World</em> star Will Friedle seemingly confirmed the story. He noted he only spent a short amount of time with the girls on set, and they were very young at the time, but the whole thing was, as he put it, “weird.” </p><div><blockquote><p>The woman, their handler, had two Dixie cups taped together with M&Ms in them. And whenever they would like, their gaze would go somewhere else, she’d go and shake the thing, and they would snap back to it; it was weird. </p></blockquote></div><p>Rider Strong also confirmed he’d heard a similar “trained with food” story, and that he heard that’s why so many <em>Full House</em> shots of the girls are singles. They were simply looking over and waiting to “get a cookie” or other snack if they fulfilled their duties on the show.  </p><p>This isn’t the first time the food thing has come up, either, leading more credence to Friedle's behind-the-scenes story. </p><h2 id="jodie-sweetin-admitted-both-girls-were-motivated-by-food-but-ashley-was-more-easy-going">Jodie Sweetin Admitted Both Girls Were Motivated By Food, But Ashley Was More Easy-Going</h2><p>The other day, I was listening to a podcast where Jodie Sweetin was talking with Andrea Barber about the Olsen sisters when they all worked together on <em>Full House</em>. There had been rumors running around for years that Mary-Kate and Ashley Olsen were incentivized with food on set, and Sweetin sort of alluded to it in an episode of “How Rude, Tanneritos.”  </p><p>We’d previously covered when a fan asked, “Was there ever a point where the directors would favor working with one twin over the other?” <a href="https://www.cinemablend.com/television/full-house-producers-had-preferred-olsen-twin-to-work-with-mary-kate-ashley"><u>The answer was Ashley was more into it</u></a>, and was more easy-going when it came to working scenes. However, Sweetin went on to note they would really only fight when it came to scenes where there would be sweet treats doled out, and they both wanted the snacks.</p><div><blockquote><p>There would be certain scenes that one would do and the other wouldn’t. Remember Adria said she had to divide up the sweets-eating scenes because that was the only thing that they were like, ‘This isn’t fair. She got more cake and I didn’t.’ So, you had to balance that out. </p></blockquote></div><p>It’s tough out there to be child actors, and <a href="https://www.cinemablend.com/television/boy-meets-worlds-rider-strong-and-will-friedle-talk-auditioning-as-child-actors-and-receiving-savage-rejections"><u>Will Friedle and Rider Strong have also previously touched on this</u></a>. Regardless, the girls’ agent, Michael Pagnotta, has said they had complete autonomy over where their careers went as they got older, noting it was the <a href="https://www.cinemablend.com/television/mary-kate-ashley-olsen-former-publicist-key-full-house-stars-own-bosses"><u>Olsens decision when they bailed “on all the entertainment stuff</u></a>.” Ultimately, at the end of the day, they are in a place now with their lives and careers where they can do what they want, but the public fascination has not subsided, and it may be a long time before it will.  </p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ The Famous Full House Home Was Going To Be An Airbnb For Fans. Then Disaster Struck ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/famous-full-house-home-was-going-to-be-airbnb-for-fans-disaster-struck</link>
                                                                            <description>
                            <![CDATA[ This is so disappointing. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">WRr4JuJ2YdkskRArqLC9Vc</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/uUrDooXcNDG6gWiPJyEwY4-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Tue, 31 Mar 2026 08:25:00 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Heidi Venable ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/w7HQ9MvRSDd7diNpTmruW9.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Heidi Venable is a Content Producer for CinemaBlend. She started freelancing for the site in 2020 and officially came on board in 2021. Her job entails writing news stories and TV reactions from some of her favorite prime-time shows like Grey&#039;s Anatomy and The Bachelor. She graduated from Louisiana Tech University with a degree in Journalism and worked in the newspaper industry for almost two decades in multiple roles including Sports Editor, Page Designer and Online Editor.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Into&lt;/strong&gt;: Heidi grew up in the 1990s, and her tastes strongly reflect that. She can (and does) quote Friends constantly, enjoys a good West Wing binge, thinks Can&#039;t Hardly Wait was the most influential movie of her life and finds solace in 311 concerts. On Sundays during football season, she can be found cheering on the New Orleans Saints with her husband and two daughters. Who Dat! She loves to read but usually settles for a pop culture podcast, and thinks the best weekends are spent cooking and playing cards with friends and family, preferably with some UFC fights or other sporting event on TV.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Excited About Right Now&lt;/strong&gt;: Football season, Pumpkin Spice Lattes and everything related to fall and cooler weather. The Game of Roses podcast and all things The Bachelor, and new episodes of Grey&#039;s Anatomy, Love Is Blind, The Voice, OMITB and more.&amp;nbsp;&lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/uUrDooXcNDG6gWiPJyEwY4-1280-80.jpg">
                                                            <media:credit><![CDATA[ABC]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Screenshot of Candace Cameron Bure and Jodie Sweetin on Full House]]></media:description>                                                            <media:text><![CDATA[Screenshot of Candace Cameron Bure and Jodie Sweetin on Full House]]></media:text>
                                <media:title type="plain"><![CDATA[Screenshot of Candace Cameron Bure and Jodie Sweetin on Full House]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/uUrDooXcNDG6gWiPJyEwY4-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>Multiple generations now have grown up with <em>Full House</em>’s Tanner family, and let’s not pretend that we haven’t all thought about <a href="https://www.cinemablend.com/television/tv-homes-that-i-always-wanted-explore-live-in">what it would be like to live in</a> that iconic Victorian home on San Francisco’s slanted Steiner Street. <em>Full House</em> creator <a href="https://www.cinemablend.com/television/House-From-Full-House-Up-Sale-Here-How-Expensive-It-141467.html">Jeff Franklin bought the house in 2016</a> and had visions of turning our dreams into a reality by renovating that famous property into a <em>Full House</em> vacation rental experience. Jodie Sweetin explained why it never came to be. </p><p>Of course, <em>Full House </em>and later <em>Fuller House</em> were not filmed in San Francisco. The set we know so well, with that wraparound staircase, was far too big for that little Victorian house, but the property <a href="https://www.cinemablend.com/television/places-that-became-famous-due-to-a-tv-show">became famous from the TV show</a>’s opening credits, which showed the exterior of the famous “Painted Ladies.” Jodie Sweetin, aka Stephanie Tanner, said as much as she told Bob the Drag Queen on his <a href="https://www.youtube.com/watch?v=TfxWeSw0NnM"><em>Only Child</em> podcast</a> about what was once planned for the home, saying:</p><div><blockquote><p>Jeff Franklin, the creator of the show, bought it and was gutting the inside. He wanted to make it into some sort of Airbnb Full House sort of thing. People would lose their minds for it. But the house is so small, like so small when you get in there, you’re like, ‘Oh there’s no way any of this could fit in there.’</p></blockquote></div><p>I’m honestly trying to imagine what a scaled-back version of Danny Tanner’s family home would look like, and all I know is that it would be impeccably clean. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="VEXPgyzkQFwmxGAcoyJAq7" name="full house house" alt="The San Francisco "Painted Ladies" home made popular by Full House is shown in the Fuller House opening credits." src="https://cdn.mos.cms.futurecdn.net/VEXPgyzkQFwmxGAcoyJAq7.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class="inline"></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><p>Jeff Franklin even apparently got the cast members to come in to make their mark on the property … before things turned sour. Jodie Sweetin continued:</p><div><blockquote><p>He was redoing it. We actually did a whole thing where we did our hands in the cement in the back of the house. The neighbors, though, heard he was doing stuff and they just petitioned the city and he couldn’t do anything.</p></blockquote></div><p>The actress said the house was actually a “nightmare” for it owners and their neighbors, due to how many tourists it attracts to San Francisco’s “Postcard Row.” Neighbors complained to the city about an endless stream of people traipsing around their neighborhood, taking photos of the famous house. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="bRsKGtBXxy5J4o6RmpLKo7" name="full house house 2" alt="The San Francisco "Painted Ladies" home made popular by Full House is shown in the Fuller House opening credits." src="https://cdn.mos.cms.futurecdn.net/bRsKGtBXxy5J4o6RmpLKo7.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class="inline"></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><p>And in a super obnoxious (but kind of funny) move, some fans would apparently drive by the houses blasting the <em>Full House</em> theme song at full volume. It got so bad that, according to Jodie Sweetin:</p><div><blockquote><p>They even had to take it off of the city bus tours. There were literally thousands of people going by in a day. You know what I mean? Like, every bus would stop.</p></blockquote></div><p>Jeff Franklin’s <em>Full House</em> Airbnb would seemingly have only brought more attention to the area. Throw in a busted gas line that made the situation better for no one, and Franklin's vision was never fully realized. He ended up <a href="https://www.cinemablend.com/television/2558546/full-house-creator-sells-famous-san-francisco-home-after-neighbors-complain">selling the house in 2020</a>.</p><p>We may not ever get to spend the night in the <em>Full House</em> house, but at least we’ll always have the Tanners. All eight seasons of the beloved sitcom are available to stream with a <a href="https://www.cinemablend.com/television/2570844/subscribing-to-hulu-the-price-whats-included-and-everything-else-to-know">Hulu subscription</a>, while <em>Fuller House</em> can be found with a <a href="https://www.cinemablend.com/streaming-news/netflix-subscription-the-plans-the-price-and-whats-included">Netflix subscription</a>.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ ‘I Can’t Imagine The BS.’ Jodie Sweetin Talks Seeing The Olsens At Bob Saget’s Funeral (And Where’s She’s At On Candace Cameron Bure) ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/jodie-sweetin-talks-seeing-olsens-bob-saget-funeral-reunion-candace-cameron-bure-history-full-house</link>
                                                                            <description>
                            <![CDATA[ It's all love from the former Full House cast, even when it's not. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">GSM5Mdyyk8nKZD5c3aCE85</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/RYrARReEPotccyADWoGKn5-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Tue, 10 Mar 2026 12:01:32 +0000</pubDate>                                                                                                                                <updated>Tue, 10 Mar 2026 15:32:26 +0000</updated>
                                                                                                                                            <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Jessica Rawden ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/gNi5ipvqyWREFVbs7Ehzx9.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background:&lt;/strong&gt; Jessica Rawden is Managing Editor at CinemaBlend. She’s been kicking out news stories at CinemaBlend since 2007 and joined the full-time staff in 2014. She oversees news content, hiring and training for the site, and her areas of expertise include theme parks, rom-coms, Hallmark (particularly Christmas movie season), reality TV, celebrity interviews and primetime. She loves a good animated movie.&amp;nbsp;&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;Jessica has a Masters in Library Science degree from Indiana University, and used to be found behind a reference desk most definitely not shushing people. She now uses those skills in researching and tracking down information in very different ways.&amp;nbsp;&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She’s Into&lt;/strong&gt;: A former soccer player and recent tennis addict, Jessica also enjoys running, both of the distance and sprint variety. When not at the movie theater or in a theme park, her other free time is spent in book clubs, hiking, drinking wine, binge-watching, keeping tabs on celebrity fashion and riding rollercoasters. Has a serious Hallmark habit and an even bigger record-buying habit. Will bake for compliments.&amp;nbsp;&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She’s Excited About Right Now&lt;/strong&gt;: &amp;nbsp;Hallmark Christmas movie season. Wearing socks to bed. &amp;nbsp;&amp;nbsp;&amp;nbsp;&amp;nbsp;&amp;nbsp;&lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/RYrARReEPotccyADWoGKn5-1280-80.jpg">
                                                            <media:credit><![CDATA[Getty Images]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Mary-Kate and Ashley Olsen both wear black and stare away from the camera. The background is pink and Mary-Kate is holding a statue. ]]></media:description>                                                            <media:text><![CDATA[Mary-Kate and Ashley Olsen both wear black and stare away from the camera. The background is pink and Mary-Kate is holding a statue. ]]></media:text>
                                <media:title type="plain"><![CDATA[Mary-Kate and Ashley Olsen both wear black and stare away from the camera. The background is pink and Mary-Kate is holding a statue. ]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/RYrARReEPotccyADWoGKn5-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <iframe src="https://content.jwplatform.com/players/upWk92Wi.html" id="upWk92Wi" title="‘I Can’t Imagine The BS.’ Jodie Sweetin Talks Seeing The Olsens At Bob Saget’s Funeral (And Where’s She’s At On Candace Cameron Bure)" width="600" height="338" frameborder="0" scrolling="auto" allowfullscreen></iframe><p>In the history of TV families, <em>Full House</em> stands out as a beloved property that has been fondly remembered for decades, and that eventually even led to the <em>Fuller House</em> spinoff. Of course, even the best of families can be messy. Jodies Sweetin and Candace Cameron Bure, for example, have <a href="https://www.cinemablend.com/television/jodie-sweetin-candid-being-very-different-from-candace-cameron-bure-faith-based-backlash"><u>had some public clashes</u></a>. Or, there’s the time the <a href="https://www.cinemablend.com/television/We-Finally-Know-Why-Olsen-Twins-Aren-t-Fuller-House-120657.html"><u>Olsen twins declined to participate</u></a> in the revival show. Sweetin was asked about this and more in a recent interview, and her take on the entire matter is quite a bit refreshing.</p><h2 id="when-it-comes-to-the-olsens-sweetin-feels-a-lot-of-empathy">When It Comes To The Olsens, Sweetin Feels A Lot Of Empathy</h2><p>Jodie Sweetin spent her formative years on the set of <em>Full House</em>, but she told Bob The Drag Queen in a <a href="https://www.youtube.com/watch?v=TfxWeSw0NnM"><u>recent interview</u></a> the girls were much younger when they kicked off their TV careers. What followed was <a href="https://www.cinemablend.com/television/the-olsen-twins-just-turned-37-and-yes-their-net-worth-is-way-greater-than-yours">a whirlwind of fame and money</a>, but looking from the outside, she personally feels Mary-Kate and Ashley Olsen were overworked. </p><div><blockquote><p>I saw how hard they were worked in order to pull all that [success] off, and I didn’t envy it at all. No, I did not. I always actually felt really bad that they had to do all that because they really lost out on having, like, a childhood.</p></blockquote></div><p>They didn’t have the same choice to be in the industry she feels she had as a younger person. On her end, the struggles in her career actually came as her years as a child actor were ending. She wasn’t sure what she would do as an adult, but she also didn’t have the millions of eyeballs following her every single moment in public her onscreen sisters did. </p><div><blockquote><p> I can’t imagine you know, the two of them, the attention that they get. The three of us were really close as kids. I was much closer with them. They came to my house on weekends. I took Mary-Kate and Ashley horseback riding for the first time. Now Mary-Kate owns horses and stuff. We would go to Disneyland together… we were really close.  I wish nothing but the best for them, but I can’t imagine all the bs that they’ve had to deal with over the years.  </p></blockquote></div><p>She’s not really surprised Mary-Kate and Ashley ultimately left the industry. (Mostly, Mary-Kate had a few roles as an adult.) Time passed and the cast grew apart. Sweetin opened up about finally <a href="https://www.cinemablend.com/television/bob-sagets-wife-says-shes-trying-not-to-feel-robbed-of-time-after-well-attended-funeral"><u>seeing the Olsens at Bob Saget’s funeral in 2022</u></a>, and how she feels about their relationship changing over time.  </p><div><blockquote><p>You know when we saw Mary-Kate and Ashley after Bob had passed that was the first time that we’d really seen each other or been together for years. They were in NY and in Europe. Also, I have to think about it like, for me, I did the show from age 5-13. That is your childhood, your memorable years. I don’t really have much memories before the show.</p></blockquote></div><p>Everyone reunited in <a href="https://www.cinemablend.com/television/bob-sagets-pals-had-a-punk-rock-shiva-after-his-fancy-funeral-with-dave-chapelle-john-mayer-what-looks-to-be-the-olsen-twins-and-more">2022 at Bob Saget's "punk rock shiva," </a>which also featured appearances from fellow comedians like Dave Chappelle and Jeff Ross, his pal John Mayer, and the dudes in the <em>Full House</em> cast. Since then, they've gone their separate ways again. Unlike the older gang, Sweetin thinks the age gap is one of the reasons the girls separated themselves from the rest of the <em>Full House</em> cast, who really have supported one another publicly and came together for the revival, which is still available to watch with a <a href="https://www.cinemablend.com/streaming-news/netflix-subscription-the-plans-the-price-and-whats-included"><u>Netflix subscription</u></a>. </p><div><blockquote><p>They started as babies and were eight when they ended. While we were all close then, do you still talk to the people from when you were seven years old? they’re just in different years now. I get it. They’re doing their own thing. It was never like we hated each other or anything like that.</p></blockquote></div><p>Now, just because Sweetin doesn’t feel any ill will towards the twins doesn’t mean there aren’t occasionally differences of opinion and disagreements within the cast. Candace <a href="https://www.cinemablend.com/television/hallmark-stars-who-left-for-gac-family-and-who-are-definitely-staying"><u>Cameron Bure’s exit from Hallmark </u></a>and <a href="https://www.cinemablend.com/television/ex-hallmark-star-hilarie-burton-went-off-on-candace-cameron-bure-after-gaf-star-said-new-movies-will-feature-traditional-marriages"><u>comments about “traditional marriage</u></a>” did inspire Sweetin to speak out against her co-star a while back. They obviously have appeared together at events since, but sometimes a <em>full</em> house can lead to conflict. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="zmW7Gr5gixjarxNC5dNc9c" name="GettyImages-1248942050" alt="Dave Coulier, Candace Cameron Bure, Andrea Barber and Jodie Sweetin Reunite at '90s Con. Their clothes are brightly colored and the background is teal." src="https://cdn.mos.cms.futurecdn.net/zmW7Gr5gixjarxNC5dNc9c.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class="inline"></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Getty Images)</span></figcaption></figure><h2 id="how-jodie-sweetin-feels-about-candace-cameron-bure-now">How Jodie Sweetin Feels About Candace Cameron Bure Now</h2><p>Sweetin has previously said she has a different viewpoint than Bure. Back in 2022, Candace posted her comments about “traditional marriage” and <a href="https://www.cinemablend.com/television/full-house-jodie-sweetin-never-actually-feuding-candace-cameron-bure-traditional-marriage-beliefs-very-different-worlds"><u>Sweetin followed up with her own comments </u></a>about being an LGBTQ ally. <a href="https://www.cinemablend.com/television/2466150/fuller-house-is-ending-but-its-not-all-bad-news"><u><em>Fuller House</em></u><u> had ended its run by that point</u></a>, and both had moved on to new projects, but <a href="https://www.cinemablend.com/television/see-full-houses-candace-cameron-bure-jodie-sweetin-reunite-90s-con-reported-feud"><u>they managed to reunite at ‘90s Con</u></a> some months later. </p><p>The actress has a very pragmatic approach to her relationship with her former co-star, noting she knows who she is as a person. But she also knows who Bure is.</p><div><blockquote><p>Candace does her thing and, you know, we sit on very opposite sides of things and I’m just, kind of, a loud, outspoken bitch about a lot of things, and that’s not going to stop me. And if that ain’t you, that ain’t you.</p></blockquote></div><p>For her part, Bure has <a href="https://www.cinemablend.com/television/after-candace-cameron-bures-alleged-beef-with-jodie-sweetin-she-and-full-house-co-star-discuss-how-cast-tends-to-bicker-like-a-family">said it's all "love" with her <em>Full</em> and <em>Fuller House</em> family</a>. She knows from the outside, it can seem like they "bicker," but she seems grateful to still be a part of the group and show that set the tone of her career. While the Olsens don't always participate, it seems like it's all love from Sweetin there, too. </p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ John Stamos, Candace Cameron Bure And More Full House Stars Shared Emotional Tributes For Bob Saget On 4th Anniversary Of His Death ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/john-stamos-candace-cameron-bure-more-full-house-stars-emotional-tributes-bob-saget-4th-anniversary-death</link>
                                                                            <description>
                            <![CDATA[ Bob Saget's friends and co-stars remember him on this unfortunate anniversary. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">ZWz6eXDGeEu49JNrHqmR2M</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/BsKJCJ7VcBrYNYaqUUnRb9-1280-80.png" type="image/png" length="0"></enclosure>
                                                                        <pubDate>Fri, 09 Jan 2026 22:07:53 +0000</pubDate>                                                                                                                                <updated>Sat, 10 Jan 2026 02:31:53 +0000</updated>
                                                                                                                                            <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Dirk Libbey ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/94xQd5ce9fq4F6ars9ZALW.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Dirk began writing for CinemaBlend as a freelancer in 2015 before joining the site full-time in 2018. He has previously held positions as a Staff Writer and Games Editor, but has more recently transformed his true passion into his job as the head of the site&#039;s Theme Park section. He has previously done freelance work for various gaming and technology sites. Prior to starting his second career as a writer he worked for 12 years in sales for various companies within the consumer electronics industry. He has a degree in political science from the University of California, Davis.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Into&lt;/strong&gt;: As the head of CinemaBlend&#039;s Theme Park Beat Dirk is a theme/amusement park junkie. Time not spent in a park is largely spent wishing he was in a park. He prefers Disneyland Resort to Walt Disney World in nearly all circumstances. He loves a good third-wave coffee house or a glass of red wine. He would enjoy video games if he ever had time to play them anymore. The Carthay Circle Lounge is his happy place.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Excited About Right Now&lt;/strong&gt;: Walt Disney World&#039;s Transformation of Epcot, Universal Orlando Resort&#039;s Epic Universe park, DisneylandForward&lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/png" url="https://cdn.mos.cms.futurecdn.net/BsKJCJ7VcBrYNYaqUUnRb9-1280-80.png">
                                                            <media:credit><![CDATA[ABC]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[bob saget on full house]]></media:description>                                                            <media:text><![CDATA[bob saget on full house]]></media:text>
                                <media:title type="plain"><![CDATA[bob saget on full house]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/BsKJCJ7VcBrYNYaqUUnRb9-1280-80.png" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>It’s hard to believe it’s been four years since <a href="https://www.cinemablend.com/television/full-house-star-bob-saget-is-dead-at-65">we lost the great comedian Bob Saget</a>. The former stand-up comic and star of <em>Full House</em> died in a tragic accident four years ago today, and several of his co-stars, Candace Cameron Bure, John Stamos and Dave Coulier, took a moment to remember him on this unfortunate anniversary.</p><p>Bure took to <a href="https://www.instagram.com/p/DTTQVqWAbp-/?img_index=1">Instagram</a> and posted a collection of photos of herself and Saget. Some of them are more recent, from the period in and around <a href="https://www.cinemablend.com/television/full-houses-jodie-sweetin-andrea-barber-weighed-in-another-spinoff-challenge-making-it">the <em>Fuller House</em> reboot</a>, but a couple of these are true throwbacks to when Candace Cameron Bure was just a kid named Candace Cameron.  It’s a relationship that has spanned most of her life, and seeing it in pictures is equal parts heartwarming and heartbreaking.</p><div class="instagram-embed"><blockquote class="instagram-media"  data-instgrm-version="6" style="width:99.375%; width:-webkit-calc(100% - 2px); width:calc(100% - 2px);"><p><a href="https://www.instagram.com/p/DTTQVqWAbp-/" target="_blank">A post shared by Candace Cameron Bure (@candacecbure)</a></p><p>A photo posted by  on </p></blockquote></div><p>Bob Saget is one of those performers that a generation grew up watching, and so it felt like they knew the man personally. He was one of <a href="https://www.cinemablend.com/television/why-full-house-bob-saget-struggled-with-being-americas-favorite-dad-according-to-jodie-sweetin-andrea-barber">America’s most famous dads</a> as Danny Tanner on <em>Full House</em>, even if <a href="https://www.cinemablend.com/television/how-full-house-stars-parents-reacted-bob-saget-dirty-jokes-around-child-actors">his stand-up work was far more mature</a>. John Stamos posted his own <a href="https://www.instagram.com/p/DTTMeSLkjqc/?img_index=20">Instagram</a> tribute, with shots from both the <em>Full House</em> days and more recent times, showing the progression of a long friendship. In his post, Stamos said…</p><div><blockquote><p>Missing Bob feels like standing in a quiet room after the laughter stops. Your ears still ring with what was there, but the sound is gone. The heart of it is gone. It’s empty. </p></blockquote></div><p>John Stamos and Bob Saget certainly came a long way. <a href="https://www.cinemablend.com/television/john-stamos-pissed-off-bob-saget-during-full-house-days-he-initially-disliked-co-star">Stamos has previously said he didn’t like his co-star</a> that much, but the two ultimately became very good friends. They spent one of their <a href="https://www.cinemablend.com/theme-parks/john-stamos-reflects-on-final-day-he-spent-with-bob-saget-at-disneyland">last days together at Stamos’ favorite place, Disneyland</a>. Considering how random and unexpected Saget’s death was, there was certainly no way to know it would be the last time they would see each other. Sagat is believed to have died from injuries sustained from an accidental fall in his hotel room in Florida where he was on tour performing stand-up. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="w9JQGXvWhdFBdWoNA28nMd" name="Full House Smash Club.jpg" alt="The Full House cast" src="https://cdn.mos.cms.futurecdn.net/w9JQGXvWhdFBdWoNA28nMd.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class="inline"></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><p>The third member of the <em>Full House</em> trio, Dave Coulier, didn’t miss the chance to tell the world what Bob Saget meant to him, in his own <a href="https://www.instagram.com/p/DTTdrEjgWD3/?img_index=1">Instagram</a> post, he said he thought his friend would want that…</p><div><blockquote><p>I have no one else like Bob in my life, but he’s given me such great memories for the rest of it. To say that I miss him is an understatement. To say to the world about how much I loved him is exactly what Bob would’ve wanted. I love you Bob. ❤️</p></blockquote></div><p>It’s clear that Bob Saget meant a lot to those whose lives he touched. For those who knew him and those wno simply watched him, we’re all poorer now that he’s gone. Our thoughts go out to his friends and family on this difficult day. </p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ ‘Completely Unacceptable’: Jodie Sweetin Gets Candid About Being ‘Very Different’ From Candace Cameron Bure After Faith-Based Backlash  ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/jodie-sweetin-candid-being-very-different-from-candace-cameron-bure-faith-based-backlash</link>
                                                                            <description>
                            <![CDATA[ But calls her "closest thing I had to a sister." ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">9m4gbci7XEDeQWY4qgWXtA</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/sZ8XMGdYtJTdXhh4CLmThG-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Sun, 21 Dec 2025 17:16:33 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Heidi Venable ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/w7HQ9MvRSDd7diNpTmruW9.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Heidi Venable is a Content Producer for CinemaBlend. She started freelancing for the site in 2020 and officially came on board in 2021. Her job entails writing news stories and TV reactions from some of her favorite prime-time shows like Grey&#039;s Anatomy and The Bachelor. She graduated from Louisiana Tech University with a degree in Journalism and worked in the newspaper industry for almost two decades in multiple roles including Sports Editor, Page Designer and Online Editor.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Into&lt;/strong&gt;: Heidi grew up in the 1990s, and her tastes strongly reflect that. She can (and does) quote Friends constantly, enjoys a good West Wing binge, thinks Can&#039;t Hardly Wait was the most influential movie of her life and finds solace in 311 concerts. On Sundays during football season, she can be found cheering on the New Orleans Saints with her husband and two daughters. Who Dat! She loves to read but usually settles for a pop culture podcast, and thinks the best weekends are spent cooking and playing cards with friends and family, preferably with some UFC fights or other sporting event on TV.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Excited About Right Now&lt;/strong&gt;: Football season, Pumpkin Spice Lattes and everything related to fall and cooler weather. The Game of Roses podcast and all things The Bachelor, and new episodes of Grey&#039;s Anatomy, Love Is Blind, The Voice, OMITB and more.&amp;nbsp;&lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/sZ8XMGdYtJTdXhh4CLmThG-1280-80.jpg">
                                                            <media:credit><![CDATA[Warner Bros.]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Jodie Sweetin as Stephanie Tanner and Candace Cameron Bure as DJ Tanner on Full House.]]></media:description>                                                            <media:text><![CDATA[Jodie Sweetin as Stephanie Tanner and Candace Cameron Bure as DJ Tanner on Full House.]]></media:text>
                                <media:title type="plain"><![CDATA[Jodie Sweetin as Stephanie Tanner and Candace Cameron Bure as DJ Tanner on Full House.]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/sZ8XMGdYtJTdXhh4CLmThG-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>It’s been fun as a fan of <em>Full House</em> to see the very real bond that formed between the actors over the eight years the beloved sitcom aired back in the ‘80s and ‘90s. However, as so many of us will be reminded this holiday season, not everybody gets along all the time. Jodie Sweetin and Candace Cameron Bure bumped heads years ago over the latter’s <a href="https://www.cinemablend.com/television/ex-hallmark-star-hilarie-burton-went-off-on-candace-cameron-bure-after-gaf-star-said-new-movies-will-feature-traditional-marriages">views on “traditional marriage”</a> and, while Sweetin has <a href="https://www.cinemablend.com/television/full-house-jodie-sweetin-never-actually-feuding-candace-cameron-bure-traditional-marriage-beliefs-very-different-worlds">denied a full-out feud</a>, she spoke candidly about what makes her and Bure “very different.”</p><p>Candace Cameron Bure <a href="https://www.cinemablend.com/television/candace-cameron-bure-explains-her-controversial-gaf-christmas-movie-quotes-after-public-backlash">responded to the backlash</a> from her infamous <a href="https://www.wsj.com/articles/candace-cameron-bure-great-american-family-11668205295">2022 WSJ interview</a> by saying that as a Christian, she loved everyone “fiercely and indiscriminately,” regardless of “race, creed, sexuality, or political party.” Jodie Sweetin, meanwhile, <a href="https://www.cinemablend.com/television/candace-cameron-bures-daughter-defends-traditional-marriage-comments-after-jojo-siwa-jodie-sweetin-and-more-fired-back-at-gaf-star">stood by those like JoJo Siwa</a> who were speaking out, which seemingly resulted in Bure <a href="https://www.cinemablend.com/television/after-jodie-sweetin-supported-jojo-siwa-during-traditional-marriage-controversy-candace-cameron-bure-seemingly-unfollowed-her-on-social-media">unfollowing her TV sister</a> on social media. The Stephanie Tanner actress got real about the ordeal on <a href="https://themomentshow.substack.com/p/what-makes-a-child-star-turn-into"><em>The Moment</em> podcast</a>, saying:</p><div><blockquote><p>Candace’s faith has always been at the forefront for her, and I have no problem with religion if it brings you peace and happiness — and not saying that her brand of religion is not necessarily peace and happiness; I don’t really know. But I do know that I don’t think that you can truly love people if you don’t respect them, and I think if you don’t respect people enough to allow them the same rights — of marriage, of bodily autonomy and all of those things — then I don’t think that you can truly love someone. It’s some sort of weird pity, and it’s not love. </p></blockquote></div><p>That’s not to say that these two don’t have love for each other — or that disagreements like this haven’t happened before. It turns out the actresses who portrayed DJ and Stephanie Tanner — the oldest and middle daughters of Bob Saget’s Danny Tanner — on <em>Full House</em> are just like any other family. Jodie Sweetin said:</p><div><blockquote><p>She was the closest thing I had to a sister. We fought like sisters. I mean, even when we were kids, you know, this is the relationship we’ve had. </p></blockquote></div><p>Jodie Sweetin, who <a href="https://www.cinemablend.com/television/jodie-sweetin-speaks-out-on-being-an-lgbtq-ally-after-brouhaha-over-candace-cameron-bures-traditional-marriage-comments">has long been an LGBTQ+ ally</a> and an activist for other causes, then suggested that treating people as less-than because they’re different goes against what Christianity is supposed to be about. She said:</p><div><blockquote><p>I think that for me, standing up to say that how we treat other humans just because they’re different from us is completely unacceptable, and I’m pretty sure that’s what Jesus would have said, but what do I know, I’m not a Christian.</p></blockquote></div><p>She said that while Candace Cameron Bure always wanted to talk about her faith, she didn’t want to get into “political stuff.” Sweetin said she had no such hangups and wasn’t afraid to have people tell her they liked her <em>Full House</em> character but didn’t like her. In her words:</p><div><blockquote><p>I try not to let other people’s perceptions of who I should be or what they expect me to be put up any barriers to who I want to be, and Candace and I, we’re very different in that regard. She kept a little more quiet about certain things, and I am just, I’m loud. I’ve always been loud.</p></blockquote></div><p>At the time that rumors swirled of a feud between the actresses, other cast members like Dave Coulier confirmed that the <a href="https://www.cinemablend.com/television/after-candace-cameron-bures-alleged-beef-with-jodie-sweetin-she-and-full-house-co-star-discuss-how-cast-tends-to-bicker-like-a-family">cast members “bicker” with each other</a> from time to time, just like any family, but they ultimately all loved each other.</p><p>You can keep up with Candace Cameron Bure and Jodie Sweetin’s views on real-world events by following them on social media. However, if you’d rather just remember them as DJ and Stephanie, all eight seasons of <em>Full House</em> can be streamed with a <a href="https://www.cinemablend.com/television/2570844/subscribing-to-hulu-the-price-whats-included-and-everything-else-to-know">Hulu subscription</a>, with the spinoff <em>Fuller House</em> available with a <a href="https://www.cinemablend.com/streaming-news/netflix-subscription-the-plans-the-price-and-whats-included">Netflix subscription</a>. </p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ John Stamos’ Son Is Trolling Him Over Full House In An A+ Way ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/john-stamos-son-trolling-him-over-full-house</link>
                                                                            <description>
                            <![CDATA[ What would Uncle Jesse think? ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">a4KauzkU8waxHjPweEVHsN</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/gB4gEscSVEWm7dYjHxUvwc-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Tue, 16 Dec 2025 16:53:00 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Megan Behnke ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/FBUR6A5F9FTHQpVfjSuYpL.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Megan Behnke has been a Freelance TV News Writer at CinemaBlend since 2021. She has worked at multiple entertainment outlets, including as a Writer and Editor at Nerds and Beyond, TV and Movie News Writer at CBR, and a Freelance Writer at TV Fanatic, writing about topics she&#039;s passionate about like pop culture. She graduated from the University of Wisconsin Oshkosh with a degree in Multimedia Journalism in 2020, writing for the school’s newspaper during her time there. Her expertise in entertainment is mainly in television, but she has written about movies, music, and local events as well.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What They&#039;re Into&lt;/strong&gt;: Megan specializes in television writing, particularly procedurals. 9-1-1 and the Chicago Franchise are currently her favorites, where she can be found obsessively watching the latest episode or coming up with theories. She also loves to listen to music, with Taylor Swift being on the top of her playlist. She isn’t a huge sports person but will occasionally root for the Green Bay Packers, Milwaukee Brewers, and Wisconsin Badgers. As for movies, it’s hard to pick a favorite, but the Marvel Cinematic Universe reigns as her favorite franchise. She used to be a book nerd in grade school, with her favorite genre being fantasy or YA. Her favorite snack is sour cream and onion Pringles, while pizza is her all-time favorite food.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What They&#039;re Excited About Right Now&lt;/strong&gt;: Manifest Season 4 finally coming to Netflix, One Chicago, and Taylor Swift’s upcoming Midnights album, which will be on repeat.&lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/gB4gEscSVEWm7dYjHxUvwc-1280-80.jpg">
                                                            <media:credit><![CDATA[Max]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Jesse on piano in Full House]]></media:description>                                                            <media:text><![CDATA[Jesse on piano in Full House]]></media:text>
                                <media:title type="plain"><![CDATA[Jesse on piano in Full House]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/gB4gEscSVEWm7dYjHxUvwc-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>Nearly 40 years after its premiere, <em>Full House </em>remains one of the <a href="https://www.cinemablend.com/television/100-best-tv-sitcoms-of-all-time-ranked">best sitcoms of all time</a>. Thanks to streaming, fans old and new are discovering it every day, including the children of <a href="https://www.cinemablend.com/television/full-house-cast-celebrates-35th-anniversary-with-lots-of-throwback-pics-and-bob-saget-love"><em>Full House</em>'s throwback-loving cast</a>. John Stamos’ son is apparently now watching the TGIF sitcom, and he can’t help but troll his dad, thankfully in an A+ way.</p><p>While Stamos has done a handful of projects since starring as Uncle Jesse, he can’t seem to get away from it, even at home now. During a recent appearance on <a href="https://www.today.com/video/john-stamos-on-palm-royale-dave-coulier-kristin-wiig-more-254289989959"><em>Today</em></a>, he was asked by co-host Craig Melvin if <a href="https://www.cinemablend.com/television/john-stamos-son-has-started-watching-full-house-since-bob-saget-died-and-the-video-is-adorable">his son was now watching <em>Full House</em></a>, and Stamos confirmed that he is, but also shared the hilarious reason for it:</p><div><blockquote><p>He watches it to mock me. [It’ll be] like, ‘Billy, put your toys away.’ [He’s like,] ‘You got it, dude!’ He’s giving me catchphrases, he wants his own catchphrase. </p></blockquote></div><p>Stamos and his wife Caitlin <a href="https://www.cinemablend.com/pop/2403751/john-stamos-welcomes-baby-boy-with-adorable-pic">welcomed Billy into the world in 2018</a>, and now that he’s seven, it sounds like he’s really starting to grasp the scope of who his father is. It’s a pretty funny realization, too. The fact that Stamos had to spend so long hearing “You got it, dude,” only to have to deal with it again from his own son (and probably more than he’d like) is truly A+ trolling. The fact that the kiddo also wants his own catchphrase might just be the best part because, really, who wouldn’t want to have their own saying?</p><p>That’s not all. Stamos also shared that Billy has been giving his own critiques of the series, and had an idea that is both hilarious and not surprising coming from a 7-year-old, and it really makes me wonder how the show would have turned out had it gone down that route all those years ago. In relation to the show's character ensemble, Stamos said:</p><div><blockquote><p>The other day he goes, ‘If they had superpowers, it’d be a little bit better.’ </p></blockquote></div><p>I absolutely love that Billy is trolling his dad when it comes to <em>Full House </em>by not just saying catchphrases but also giving his own opinion on how the show would be better. Of course, <em>Full House </em>ran for eight seasons and nearly 200 episodes and is a cultural phenomenon to this day, so I think it’s pretty safe to say that even without the superpowers, the show is a success. But that doesn’t really seem to matter to Billy, because at his age, kids believe that everything needs to be superpowered. </p><p>Plus, I think we can all agree Danny Tanner's cleaning skills were nothing short of super. </p><p>Perhaps if there is another <em>Full House </em>series in the very distant future, it doesn’t have to be just <a href="https://www.cinemablend.com/television/jodie-sweetin-has-idea-full-house-cast-should-do-another-series-i-dont-hate-it"><em>Golden Girls</em>-esque like Jodie Sweetin suggested</a>. Maybe there can be some type of superhero aspect of it, even if it is just in a crazy dream sequence. You never know. At the very least, it’s fun that John Stamos’ kid is watching <em>Full House</em>, regardless of the reason and the jokes that come along with it. Maybe he’ll even follow in his dad’s footsteps and lead a sitcom in the future where he can have his own catchphrase and superpowers.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ John Stamos And Full House Fans Send Love To Dave Coulier After His Latest Cancer Diagnosis ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/john-stamos-full-house-fans-send-love-dave-coulier-after-latest-cancer-diagnosis</link>
                                                                            <description>
                            <![CDATA[ Fans are showing some major love. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">mkMrq8CKFXPmRpHqxz7Uq3</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/FBUwKmBvD8vtfLaCYeYsU-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Tue, 02 Dec 2025 21:41:57 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Erik Swann ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/rXkznL7DwWNoGfjx998J3Q.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Erik Swann is a Senior Content Producer at CinemaBlend. He began working with the publication in 2020 when he was hired as Weekend Editor. Today, he continues to write, edit and handle social media responsibilities over the weekend. On weekdays, he also writes TV and movie-related news and helps out with editing and social media as needed. He graduated from the University of Maryland, where he received a degree in Broadcast Journalism. After shifting into multi-platform journalism, he started working as a freelance writer and editor before joining CB. During his time with the site, he&#039;s been able to cover some excellent TV shows and films and interview some wonderful stars.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Into&lt;/strong&gt;: Erik is a superhero fan, and his love for comic books began after he first watched Batman: The Animated Series as a child. He also enjoys comedies, action/adventure flicks, dramas and science fiction. He has a love for sports as well, particularly professional basketball. Though he&#039;s a Maryland/Washington D.C. native, he roots for the Boston Celtics. Some of his all-time favorite TV shows are BTAS, Breaking Bad, Sanford and Son, Agents of S.H.I.E.L.D., Better Call Saul and Atlanta. And when it comes to movies, Beverly Hills Cop, A Raisin in the Sun, Toy Story, Iron Man, Star Wars, and Wall Street are among his favorites. He also enjoys a good pizza (preferably with pepperoni and mushrooms) while he&#039;s watching entertaining films and TV series.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Excited About Right Now&lt;/strong&gt;: Teenage Mutant Ninja Turtles: Mutant Mayhem, Reservation Dogs Season 3, Ahsoka, Loki Season 2, Invincible Season 2, Next Goal Wins and Chicken Run: Dawn of the Nugget.&lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/FBUwKmBvD8vtfLaCYeYsU-1280-80.jpg">
                                                            <media:credit><![CDATA[Netflix]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Dave Coulier as Uncle Joey on Fuller House.]]></media:description>                                                            <media:text><![CDATA[Dave Coulier as Uncle Joey on Fuller House.]]></media:text>
                                <media:title type="plain"><![CDATA[Dave Coulier as Uncle Joey on Fuller House.]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/FBUwKmBvD8vtfLaCYeYsU-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>Over the past year, Dave Coulier has been candid about his health challenges. Coulier – who’s best known for his role as Joey Gladstone on <em>Full House</em> and <em>Fuller House</em> – revealed in November 2024 that he’d been <a href="https://www.cinemablend.com/television/see-john-stamos-candace-cameron-bure-lovely-messages-full-house-co-star-dave-coulier-cancer-battle">diagnosed with Stage 3 non-Hodgkin lymphoma</a>. The beloved actor and comedian has been in remission when it comes to that disease but, unfortunately, Coulier just revealed he’s been diagnosed with another form of cancer. Now, longtime friend and former co-star John Stamos, and a host of fans, are sending him love. </p><h2 id="dave-coulier-opens-up-about-being-diagnosed-with-cancer-again">Dave Coulier Opens Up About Being Diagnosed With Cancer Again</h2><p>Coulier revealed on Tuesday, December 2, that he’d been diagnosed with tongue cancer. While opening up about the diagnosis on <a href="https://www.today.com/health/news/dave-coulier-tongue-cancer-rcna245598">Today</a>, the 66-year-old star said the cancer was detected during a PET scan this past October, at which point doctors noticed that a previously discovered growth on his tongue had expanded. After a biopsy was conducted, it was formally deduced that the comedian contracted early stage, P16-positive oropharyngeal squamous cell carcinoma. Coulier recalled being taken aback by the news: </p><div><blockquote><p>They said it’s totally unrelated to my non-Hodgkin’s lymphoma. This is a new cancer. ... I said, 'Are you kidding me?’</p></blockquote></div><p>The American Cancer Society says the P16 protein serves as an indicator for human papillomavirus (or HPV). When it comes to P16-positive cancer, HPV-16 – a sexually transmitted infection, causes it. A silver lining to Dave Coulier’s position as a “positive” patient is that the outlook is much better for those who are in the “negative” category. Coulier – who just shared seven months ago that <a href="https://www.cinemablend.com/television/candace-cameron-bure-dave-coulier-wholesome-exchange-after-announced-cancer-free-poopoo-nickname">he was cancer-free</a> – also expressed optimism over his treatment: </p><div><blockquote><p>We found it early enough where it’s very treatable. ... It’s got a 90% curability rate. The doctor said the prognosis is good, but we're going to start radiation immediately.</p></blockquote></div><p>On the whole, Coulier is undergoing 35 treatments, per Today, and those will last until the end of this year. Although it’s unfortunate to hear that the <em>Real Ghostbusters</em> icon is contending with yet another cancer battle, it’s comforting that his prognosis looks good. What’s also heartwarming is the array of well wishes he’s been receiving following the announcement. </p><h2 id="john-stamos-and-fans-reach-out-to-dave-coulier-amid-his-diagnosis">John Stamos And Fans Reach Out To Dave Coulier Amid His Diagnosis</h2><p>The casts of <em>Full House</em> and <em>Fuller House</em> (which are available to stream with a <a href="https://www.cinemablend.com/streaming-news/netflix-subscription-the-plans-the-price-and-whats-included">Netflix subscription</a> and <a href="https://www.cinemablend.com/television/2570432/subscribing-to-hbo-max-what-to-know-about-the-price-options-and-what-the-streaming-service-offers">HBO Max subscription</a>, respectively) have remained close over the years. So it wasn’t surprising to me in the slightest that John Stamos (who played Jesse Katsopolis on both sitcoms) shouted out Dave Coulier following his cancer announcement. Stamos screenshotted an image from Coulier’s <em>Today</em> interview and shared it to his <a href="https://www.instagram.com/johnstamos/">Instagram</a> story. He also shared a two-word caption: </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:177.58%;"><img id="jbAFiPhEYdKtYsmBCWZjWg" name="john stamos ig story" alt="John Stamos' Instagram story" src="https://cdn.mos.cms.futurecdn.net/jbAFiPhEYdKtYsmBCWZjWg.jpg" mos="" align="middle" fullscreen="" width="1280" height="2273" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Instagram)</span></figcaption></figure><p>Stamos previously went viral for supporting Coulier after his first cancer diagnosis by donning a bald cap as a way of showing solidarity with his buddy’s newly shaved head. The <em>Grandfathered</em> actor received backlash for the movie, though <a href="https://www.cinemablend.com/television/people-complained-john-stamos-wore-bald-cap-in-support-of-full-house-co-star-and-dave-coulier-response">Coulier swiftly responded</a>, saying that Stamos’ gesture was well-timed and needed. Around that same time, some other former castmates like Candace Cameron Bure and Jodie Sweetin showed love as well as fans. Now, fans are showing love again, and some of the <a href="https://www.instagram.com/p/DRw9ekrgKSI/">Instagram</a> comments can be seen below:</p><ul><li>Always rooting for you Dave 💙 - <strong>tarabpow</strong></li><li>Hanging my head low my friend! I’m praying for you!❤️ You’re loved! - <strong>holly393</strong></li><li>We love you! :) - <strong>grantfieldgrove2.0</strong></li><li>Praying for a speedy recovery and you being here for a long time, so sorry to hear about the news. - <strong>alexnnextdoorr</strong></li><li>Praying for you for a speedy recovery 🙏 ♥️. Your positive attitude is an encouragement to many. - <strong>caridolce</strong></li><li>I so admire your strength, resilience, positive attitude and your amazing talent both as an entertainer AND as a painter. Wishing you sunshine, health, longevity and ecommerce success. You got this! ❤️ 🙏🏻 💯 - <strong>diamaalia</strong></li></ul><p>The love for Dave Coulier – who’s still been attending conventions this year – is real, and he himself hasn’t shied away from the legacy of <em>Full House</em> or its continuation series. Back in 2023, Coulier actually <a href="https://www.cinemablend.com/television/jodie-sweetin-dave-coulier-launched-full-house-podcasts-love-fest-bob-saget">launched the <em>Full House Rewind</em> podcast</a>. It’s incredibly sweet that the fanbase still has as much for Coulier as he has for them. On that note, let’s send Coulier all of the positive vibes as he undergoes this latest round of treatment.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ Turns Out Full House’s Producers Had A Preferred Olsen Twin To Work With Early On ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/full-house-producers-had-preferred-olsen-twin-to-work-with-mary-kate-ashley</link>
                                                                            <description>
                            <![CDATA[ The truth behind Michelle’s earliest scenes. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">pCxEGejYa5a2ddQfcMa3Ti</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/vcj3duh7dsJYy3py7au6Cd-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Mon, 01 Dec 2025 17:46:58 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Ryan LaBee ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/XbAXNYeMUxUvrHFt3Cg5KE.jpeg ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background:&lt;/strong&gt; Ryan graduated from Missouri State University with a BA in English/Creative Writing.&amp;nbsp;&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Into:&lt;/strong&gt; He loves all things horror. An avid fan of Game of Thrones and House of the Dragon. Lifelong comic book fan.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Excited About Right Now:&lt;/strong&gt; Ryan&#039;s really excited for House of the Dragon and Hulu&#039;s Hellraiser reboot!&lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/vcj3duh7dsJYy3py7au6Cd-1280-80.jpg">
                                                            <media:credit><![CDATA[Max]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Michelle in Full House]]></media:description>                                                            <media:text><![CDATA[Michelle in Full House]]></media:text>
                                <media:title type="plain"><![CDATA[Michelle in Full House]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/vcj3duh7dsJYy3py7au6Cd-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>If you grew up watching one of the <a href="https://www.cinemablend.com/television/100-best-tv-sitcoms-of-all-time-ranked">greatest sitcoms of all time</a> <em>Full House</em>, you probably assumed <a href="https://www.cinemablend.com/television/mary-kate-ashley-olsen-rare-public-appearance-harder-tell-them-apart">Mary Kate and Ashley Olsen</a> traded off the role of <a href="https://www.cinemablend.com/television/story-behind-why-tia-tamera-mowry-used-watch-mary-kate-ashley-olsen-full-house">Michelle Tanner with perfect twins-in-sync energy</a>. But according to two of the Tanner family’s own, things were not quite that smooth at first. It turns out the producers did favor one Olsen twin during the early days, and the reason why says a lot about the girls’ very different baby personalities.</p><p><a href="https://www.cinemablend.com/television/full-house-jodie-sweetin-andrea-barber-address-weird-question-theyre-often-asked-john-stamos-fans-think-tanners-the-brady-bunch">Jodie Sweetin and Andrea Barber answered fan questions </a>on a recent episode of their podast, <a href="https://www.iheart.com/podcast/1119-how-rude-tanneritos-118613484/episode/minisode-fan-emails-308307174/"><u><em>How Rude, Tanneritos!</em></u></a>  When after joking about long shoot days and imagining how the <a href="https://www.cinemablend.com/television/my-kids-i-watched-too-much-full-house-but-made-me-look-one-character-differently"><em>Full House</em> characters </a>would fare in a pandemic, Sweetin slipped in a detail that fans might not know: the twins did not have the same temperament on set, which shaped how often each was used. Sweetin explained:</p><div><blockquote><p>Well, it's a really good question, and I would say, yes, there was a point when they favored working with one over the other, but it was at the beginning, right as Mary-Kate was not — Mary-Kate did not like being sort of out on set, but Ashley was like, ‘Oh, whatevs.’ She was much more kind of docile about it, which is funny, when I think about them as people, because I’m like, that’s absolutely who they are. Ashley will be like, ‘Sure, whatevs.’ Mary Kate was like, ‘I don't want to do this.’</p></blockquote></div><p>The preference evidently had nothing to do with talent and everything to do with toddler mood swings. Ashley was simply more willing to be out in the lights and chaos of a sitcom set, while Mary Kate needed a little more emotional runway. Because of that, Ashley often ended up stepping in for the scenes that had to move quickly. Sweetin added that the twins’ cooperation could shift from moment to moment:</p><div><blockquote><p>Or there would be certain scenes that one would do and what the other one wouldn't or something like that.</p></blockquote></div><p>Barber, who played the hilariously obnoxious <a href="https://www.cinemablend.com/television/full-houses-jodie-sweetin-andrea-barber-weighed-in-another-spinoff-challenge-making-it">Kimmy Gibbler on the original ABC run</a> and later on <em>Fuller House</em>, backed her up. She explained that producers frequently adjusted their approach depending on which twin was in a better mood for the job. As she put it:</p><div><blockquote><p>One would want to do a certain scene because it was more fun for them and the other one didn't care.</p></blockquote></div><p>It is a charming bit of behind-the-scenes insight, especially considering how iconic Michelle Tanner became. The Olsens’ performance may look effortless on screen. But in reality, it relied on producers staying flexible and using whichever toddler showed up ready to hit a mark or land a punchline. Looking back, Sweetin and Barber think those early differences match who the twins grew into as adults. Ashley has always projected a calm steadiness, while Mary Kate has carried a bit more edge and intensity.</p><p>So yes, there was a preferred twin at the show’s beginning. But it was not about favoritism. It was simply about which little girl was willing to be the youngest Tanner in that exact moment. And as a parent of both a toddler and a teenager, I completely understand it. Toddlers move at their own pace and on their own schedule. Honestly, it is a miracle the show captured as many unforgettable Michelle moments as it did.</p><p>If you’re feeling the urge to revisit all eight seasons of the iconic show, <em>Full House</em> is streaming for everyone with a <a href="https://www.cinemablend.com/news/2492773/how-to-best-use-disney-tips-to-get-the-most-out-of-the-streaming-service">Disney+ subscription</a>. And you can continue on to the sequel series, <a href="https://www.cinemablend.com/television/2485629/fuller-house-why-the-mary-kate-and-ashley-cameo-never-happened">sans the twins playing Michelle</a>, with a <a href="https://www.cinemablend.com/streaming-news/netflix-subscription-the-plans-the-price-and-whats-included">Netflix subscription.</a></p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ John Stamos Seriously Went Off About Lori Loughlin’s Ex Mossimo Guinolli: ‘She Put Up With A Lot’ ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/john-stamos-seriously-went-offlori-loughlin-ex-mossimo-guinolli</link>
                                                                            <description>
                            <![CDATA[ Tell us how you really feel. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">V7tWnxxaAyiSVAWinqJjZa</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/gSXoAxba3zfWFwGa9YkAUH-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Tue, 21 Oct 2025 16:26:36 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Heidi Venable ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/w7HQ9MvRSDd7diNpTmruW9.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Heidi Venable is a Content Producer for CinemaBlend. She started freelancing for the site in 2020 and officially came on board in 2021. Her job entails writing news stories and TV reactions from some of her favorite prime-time shows like Grey&#039;s Anatomy and The Bachelor. She graduated from Louisiana Tech University with a degree in Journalism and worked in the newspaper industry for almost two decades in multiple roles including Sports Editor, Page Designer and Online Editor.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Into&lt;/strong&gt;: Heidi grew up in the 1990s, and her tastes strongly reflect that. She can (and does) quote Friends constantly, enjoys a good West Wing binge, thinks Can&#039;t Hardly Wait was the most influential movie of her life and finds solace in 311 concerts. On Sundays during football season, she can be found cheering on the New Orleans Saints with her husband and two daughters. Who Dat! She loves to read but usually settles for a pop culture podcast, and thinks the best weekends are spent cooking and playing cards with friends and family, preferably with some UFC fights or other sporting event on TV.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Excited About Right Now&lt;/strong&gt;: Football season, Pumpkin Spice Lattes and everything related to fall and cooler weather. The Game of Roses podcast and all things The Bachelor, and new episodes of Grey&#039;s Anatomy, Love Is Blind, The Voice, OMITB and more.&amp;nbsp;&lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/gSXoAxba3zfWFwGa9YkAUH-1280-80.jpg">
                                                            <media:credit><![CDATA[Netflix]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Lori Loughlin and John Stamos on Fuller House.]]></media:description>                                                            <media:text><![CDATA[Lori Loughlin and John Stamos on Fuller House.]]></media:text>
                                <media:title type="plain"><![CDATA[Lori Loughlin and John Stamos on Fuller House.]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/gSXoAxba3zfWFwGa9YkAUH-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>Earlier this month, it was announced that <em>Full House</em> alum Lori Loughlin was separating from Mossimo Guinolli, her husband of 28 years. The <a href="https://www.cinemablend.com/tag/celebrity-divorces">celebrity breakup</a> comes five years after the couple <a href="https://www.cinemablend.com/television/2560725/lori-loughlin-has-been-released-from-prison-after-her-part-in-the-college-admissions-scandal">served time in prison</a> for their roles in the college admission scandal that got daughters Olivia Jade and Isabella Rose into USC under false pretenses. John Stamos apparently has some strong feelings about Guinolli, and he absolutely went off in defense of his former co-star.</p><p>John Stamos played Jesse Katsopolis on <em>Full House</em> several decades ago, with his character eventually marrying Lori Loughlin’s Rebecca Donaldson. The actors <a href="https://www.cinemablend.com/television/2381312/full-houses-lori-loughlin-still-gets-asked-why-she-didnt-marry-john-stamos">never took their romance off the screen</a>, but just like most of the <em>Full</em> and <em>Fuller House</em> family, they’ve remained close friends. So when Stamos got to talking about Loughlin’s marriage coming to an end on the <a href="https://www.youtube.com/watch?v=GsBcz5Cbr5Y"><em>Good Guys</em> podcast</a>, he really didn’t hold back on how he thought his friend was better off. Stamos said:</p><div><blockquote><p>I told her, I said, ‘Look, whatever negativity or hardships that you've been through in your life is connected to this guy.’</p></blockquote></div><p><a href="https://www.cinemablend.com/television/john-stamos-is-allegedly-devastated-his-full-house-family-is-falling-apart-in-the-wake-of-candace-cameron-bure-comments-and-other-incidents">John Stamos was reportedly devastated</a> about what happened to Lori Loughlin amidst her legal issues, as she was <a href="https://www.cinemablend.com/television/2468440/fuller-house-drops-lori-loughlin-from-final-season-in-wake-of-college-admissions-scandal">written off of <em>Fuller House</em></a> and <a href="https://www.cinemablend.com/television/2468417/lori-loughlin-dropped-by-hallmark-channel-after-college-admissions-scandal">fired by Hallmark</a>, where she starred in <em>When Calls the Heart</em>. <a href="https://www.cinemablend.com/television/john-stamos-drops-f-bomb-while-talking-about-lori-loughlins-journey-after-college-admissions-scandal">Stamos has defended her</a> over the college admission scandal, saying she didn’t know what was going on. </p><p>He doubled down on that sentiment on the podcast, blaming Mossimo Guinolli — “She goes to fucking prison for this asshole.” — and saying she “didn’t deserve to be dragged through that.” When co-host Ben Soffer mentioned <a href="https://pagesix.com/2025/10/17/celebrity-news/lori-loughlin-sought-divorce-over-trust-issues-source/">rumors of infidelity</a>, John Stamos refused to confirm or deny but said:</p><div><blockquote><p>I’m taking the fifth on that. Whatever he did to her, it busted her up to the core, and she put up with a lot over the years of this guy. And again, I'm not going to get into the relationship. It's not my business. I know a lot, and I was by her side through a lot of it. She is an angel, and she always made things better. She cleaned everything up. </p></blockquote></div><p>Lori Loughlin’s actions following her release from prison in 2020 seem to back up John Stamos’ words, as <a href="https://www.cinemablend.com/television/the-unexpected-way-lori-loughlin-spent-nearly-dollar500000-after-college-admissions-scandal">she reportedly spent $500,000</a> — the same amount she and her husband were accused of illegally donating — to pay the full tuition and expenses for two other students to attend USC for four years.</p><p>As strong as the bond seems to be between the Uncle Jesse and Aunt Becky actors, there’s no love lost between John Stamos and Mossimo Guinolli, as the <em>Grandfathered</em> star continued:</p><div><blockquote><p>He's a very successful dude, I will never talk to him again. He’s a terrible narcissist, and I don’t think you ever get out of that unless you’re able to. I know a little about his history, his family a little bit. I think when you have a wife like that and a family, how do you bust that up?</p></blockquote></div><p>John Stamos thinks Mossimo Guinolli fumbled big time with Lori Loughlin, and the actor predicts Guinolli might come to regret some of his actions in the future. Stamos concluded:</p><div><blockquote><p>Here’s what the honest to God truth [is], I pray for this guy. I pray that he gets a hold of whatever hole that he's trying to fill, however he's trying to fill it. I pray that he realizes that what he had was everything that anyone could ever hope for and that he gets some help. I think this guy needs help.</p></blockquote></div><p>There’s certainly no mystery about what John Stamos thinks of his friend’s ex, and while we can’t be sure what Lori Loughlin thinks about his candidness, it’s probably nice to have people like Stamos who are willing to go so hard in the paint for you.</p><p>If you want to see John Stamos and Lori Loughlin share the screen, all eight seasons of <em>Full House</em> are available to stream with a <a href="https://www.cinemablend.com/television/2570844/subscribing-to-hulu-the-price-whats-included-and-everything-else-to-know">Hulu subscription</a>.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ 32 Movies And TV Shows About Single Parents ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/movies/movies-tv-shows-about-single-parents</link>
                                                                            <description>
                            <![CDATA[ Single moms and dads can do it all! ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">Kk6xYZtuaumiHNPycouzJ7</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/PuDviiGqvZZ2wCQLJVKFX7-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Sun, 28 Sep 2025 22:32:38 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Movies]]></category>
                                                                                                                    <dc:creator><![CDATA[ Hugh Scott ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/gqJyioXTNQbSAisiNzZfAG.jpeg ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;The Background: Hugh Scott is the Syndication Editor for CinemaBlend. Before CinemaBlend, he was the managing editor for Suggest.com and Gossipcop.com, covering celebrity news and debunking false gossip. He has been in the publishing industry for almost two decades, covering pop culture – movies and TV shows, especially – with a keen interest and love for Gen X culture, the older influences on it, and what it has since inspired.&amp;nbsp;&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;He graduated from Boston University with a degree in Political Science but cured himself of the desire to be a politician almost immediately after graduation.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;What He&#039;s Into: When not writing and editing, he is usually going to concerts, curating playlists on Spotify, or watching concert films. In addition to music, he cooks, cleans, and fixes things around the house, especially things his 10-pound terror of a dog has destroyed in a fit of bordem.&amp;nbsp;&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;What He&#039;s Excited About Right Now: &amp;nbsp;Trips to the Cayman Islands and Alaska in 2024, and, as always, all the upcoming concerts he plans to attend.&amp;nbsp;&lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/PuDviiGqvZZ2wCQLJVKFX7-1280-80.jpg">
                                                            <media:credit><![CDATA[Universal Pictures]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Julia Roberts and baby in Erin Brockovich]]></media:description>                                                            <media:text><![CDATA[Julia Roberts and baby in Erin Brockovich]]></media:text>
                                <media:title type="plain"><![CDATA[Julia Roberts and baby in Erin Brockovich]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/PuDviiGqvZZ2wCQLJVKFX7-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>There are a ton of dramatic and funny stories that come from the lives of single parents. Movies and TV shows have often leaned into relationships like this across basically every genre. Sometimes they are fun and funny, and sometimes, just like real life, they are serious or heartbreaking. This list doesn't separate them, as it all adds to the rich tapestry of life. Here's our list of great movies and TV shows about the lives of single parents. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="2BYp9BqThPFx3xLRioiQcA" name="Jerry Maguire single parent" alt="Renée Zellweger and a boy in Jerry Maguire, sitting on a plane." src="https://cdn.mos.cms.futurecdn.net/2BYp9BqThPFx3xLRioiQcA.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Sony Pictures)</span></figcaption></figure><h2 id="jerry-maguire">Jerry Maguire</h2><p><em>Jerry Maguire</em> is a movie that kind of defies genre, but at its heart, it's certainly a romance story. One of the best parts of the movie is the performance of child actor Jonathan Lipnicki, who plays an only child living with his single mother (at least at the beginning of the movie). Renée Zellweger, of course, plays his mother, whose faith in Jerry (Tom Cruise) pays off big time for everyone. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Z2XoShLCLVohmXt7eHtj7c" name="diffrentstrokesconradbain.jpg" alt="Conrad Bain on Diff'rent Strokes" src="https://cdn.mos.cms.futurecdn.net/Z2XoShLCLVohmXt7eHtj7c.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="diff-rent-strokes">Diff'rent Strokes</h2><p>In <em>Diff'rent Strokes</em>, Mr. Drummond (Conrad Bain) is already a widowed parent of two kids when he takes in two more kids, Willis (Todd Bridges) and Arnold (Gary Coleman). The two kids upend the lives of the rich family on the Upper East Side of Manhattan, much to the delight of audiences of the Gen X classic.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="hRQzDeDXpDNhyTSgwDA2JZ" name="som music festival.jpg" alt="The Sound of Music" src="https://cdn.mos.cms.futurecdn.net/hRQzDeDXpDNhyTSgwDA2JZ.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney+)</span></figcaption></figure><h2 id="the-sound-of-music">The Sound Of Music</h2><p>If all you know about <em>The Sound of Music</em> is that the hills are alive, you might not realize that it's about a single father raising his seven children in Austria. Maria, played by the legendary Julie Andrews, is hired to help Captain von Trapp (Christopher Plummer), and she brings so much more to the table. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="KCGq2Muchr8UvaYuDKo5Ld" name="gilmore girls the cw" alt="alexis bledel and lauren graham on gilmore girls" src="https://cdn.mos.cms.futurecdn.net/KCGq2Muchr8UvaYuDKo5Ld.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: The CW)</span></figcaption></figure><h2 id="gilmore-girls">Gilmore Girls</h2><p>One of the most popular TV shows about a single mom and her relationship with her daughter is unquestionably <em>Gilmore Girls</em>. The show gained a very loyal following over its seven-season run, and it remains incredibly popular with the people who were drawn to it in the first place. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="rLDcNRUhGAGPL7DfSD9PmV" name="Mom.jpg" alt="Allison Janney and Anna Faris on Mom" src="https://cdn.mos.cms.futurecdn.net/rLDcNRUhGAGPL7DfSD9PmV.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="mom">Mom</h2><p>There are really two kinds of family sitcoms in TV history, one side is the idyllic family with perfect relationships, personified by shows like <em>The Cosby Show</em> and <em>The Brady Bunch, </em>and the other is more dysfunctional families, like <em>Married with Children. Mom</em>, starring Allison Janney and Anna Faris, definitely falls into the latter category. Still, at least until <a href="https://www.cinemablend.com/television/anna-faris-opens-up-about-nearly-leaving-acting-after-quitting-cbs-mom-and-what-brought-her-back">Faris left the show</a>, it was hilarious. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="GUnVMr3fuBrfbRfoV4cEHR" name="Sleepless-in-Seattle-HERO" alt="A still of Tom Hanks in Sleepless in Seattle" src="https://cdn.mos.cms.futurecdn.net/GUnVMr3fuBrfbRfoV4cEHR.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: TriStar Pictures)</span></figcaption></figure><h2 id="sleepless-in-seattle">Sleepless In Seattle</h2><p>Rom-coms like the '90s classic <em>Sleepless in Seattle </em>are always fertile ground to explore single-parent/child relationships. In the movie, Tom Hanks is a widower raising his son who grabs the attention of a journalist (Meg Ryan) after his son calls a radio talk show looking for a partner for his dad. It's a sweet story, of course, and the dynamic between father and son is so darn wholesome! It helps make it one of the <a href="https://www.cinemablend.com/new/30-Best-Romantic-Comedies-All-Time-43134.html">best rom-coms of all time</a>. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="NU4d8ymeEhXm2gt6MGHU5J" name="The Single Moms Club" alt="Two women looking skeptical in The Single Moms Club" src="https://cdn.mos.cms.futurecdn.net/NU4d8ymeEhXm2gt6MGHU5J.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Lionsgate)</span></figcaption></figure><h2 id="the-single-moms-club">The Single Moms Club</h2><p>The Tyler Perry joint <em>The Single Moms Club</em> is a unique take here. It doesn't follow one single mom, but five. The five, who have little in common beyond their marital status, find themselves thrown together planning an event at their kids' school because all of their kids keep getting in trouble. It plays out pretty much as you expect, but it is charming at times. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="goa82WXXSQuCnqWRyGHDxH" name="cde4d01ab42973e58e61c6df3692095c (1).jpg" alt="Sally Field in Forrest Gump." src="https://cdn.mos.cms.futurecdn.net/goa82WXXSQuCnqWRyGHDxH.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Paramount Pictures)</span></figcaption></figure><h2 id="forrest-gump">Forrest Gump</h2><p>I'll be the first to admit that I don't care for <em>Forrest Gump</em>. I think it's overwrought Boomer nostalgia (albeit with a great soundtrack). However, the one piece of the story I do think is well done is the relationship between Forrest (Tom Hanks) and his mother, played by Sally Field. Forrest's mom's determination to give Forrest as normal a life is actually inspiring, despite all the silliness that follows in Forrest's life. D- movie, A+ relationship.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="aBH8CMwon6rSdqUJSZeTSQ" name="Arrested Development M and GM" alt="Michael Cera and Jason Bateman sitting in the stairs truck in Arrested Development." src="https://cdn.mos.cms.futurecdn.net/aBH8CMwon6rSdqUJSZeTSQ.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="arrested-development">Arrested Development</h2><p>The dynamic between Michael (Jason Bateman) and his son George Michael (Michael Cera) is one of the key components that makes <em>Arrested Development </em>one of my favorite sitcoms of all time. Bateman plays the straight man in the show, surrounded by completely ridiculous family members, and George Michael is definitely among them, even if he is trying a little harder than the rest of the family to be a good person. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="dijpKdJFyqpEAVQAu5z5YE" name="erinbrockovichjuliaroberts.jpg" alt="Julia Roberts in Erin Brockovich" src="https://cdn.mos.cms.futurecdn.net/dijpKdJFyqpEAVQAu5z5YE.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Universal)</span></figcaption></figure><h2 id="erin-brockovich">Erin Brockovich</h2><p>Julia Roberts plays the real-life Erin Brockovich in the movie of the same name, and while her status as a single mother is only tangentially explored in the movie, it's the whole reason the character (and the real woman) ended up in a position to do what she did. Never underestimate a determined single mother! </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="vEv3jVAPs6xcBP5Y4vk7YB" name="david harbour stranger things" alt="david harbour on stranger things" src="https://cdn.mos.cms.futurecdn.net/vEv3jVAPs6xcBP5Y4vk7YB.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="stranger-things">Stranger Things</h2><p>I have a complicated relationship with <em>Stranger Things. </em>I think the plot is brilliant and I love the stories, but I am on record as a Gen Xer who is <a href="https://www.cinemablend.com/movies/wake-beetlejuice-beetlejuice-gen-xer-had-enough-nostalgia">annoyed with Gen X nostalgia</a>. Obviously, the show, available with a <a href="https://www.cinemablend.com/streaming-news/netflix-subscription-the-plans-the-price-and-whats-included">Netflix subscription</a>, fits the bill for this list, no matter how I feel about it. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="qetowm2GBV2QEjUqDnKhC6" name="dreamt2" alt="Scene from a crazy dream sequence in Terminator 2: Judgment Day" src="https://cdn.mos.cms.futurecdn.net/qetowm2GBV2QEjUqDnKhC6.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Tri-Star Pictures)</span></figcaption></figure><h2 id="terminator-2-judgment-day">Terminator 2: Judgment Day</h2><p>"Single Parent" might not be the first thing that pops into your head when you think about the <em>Terminator</em> franchise, but the relationship between Sarah Connor (Linda Hamilton) and John (Edward Furlong) is critical to the series, and no more so than in the second installment, <em>Terminator 2: Judgment Day</em>. It's certainly not a traditional mother/son relationship. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="uUoLhZhHSzQJVpZx3yVoiY" name="Julia Diahann Carroll" alt="A mother and her son eating breakfast in Julia" src="https://cdn.mos.cms.futurecdn.net/uUoLhZhHSzQJVpZx3yVoiY.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="julia">Julia</h2><p>You might not be familiar with the ABC sitcom <em>Julia</em>, but it was one of the most groundbreaking television shows of all time. Diahann Carroll, who played Julia, a single mother of a son, <a href="https://www.cinemablend.com/television/women-who-changed-television-forever">changed TV forever</a>, both as a female lead in a sitcom and as an African-American actor as the lead in any show. The fact that she was a single mom is yet another way she broke new ground. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="jyo9yCuQcuaHojKsVsz4M8" name="Screenshot (673).png" alt="Meryl Streep and Amanda Seyfried in Mamma Mia!" src="https://cdn.mos.cms.futurecdn.net/jyo9yCuQcuaHojKsVsz4M8.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Universal Pictures)</span></figcaption></figure><h2 id="mamma-mia">Mamma Mia!</h2><p>Like a few other movies on this list, <em>Mamma Mia!</em> might not jump off the page as a single-parent story, but, of course, it is. Meryl Streep and Amanda Seyfried play mother and daughter, and, like others on this list as well, it's about the daughter hoping to set up the parent with a new partner. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="yQhoQsxeDEZNy9CWCfKze" name="the parent trap.png" alt="Lindsay Lohan and Natasha Richardson in The Parent Trap." src="https://cdn.mos.cms.futurecdn.net/yQhoQsxeDEZNy9CWCfKze.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney)</span></figcaption></figure><h2 id="the-parent-trap">The Parent Trap</h2><p>I just had to include <em>The Parent Trap</em>. It's not about one single parent, but two! Sure, they were once married to each other, and sure, the plot, when you really look at it, is, frankly, disturbing. Like, why were two twins separated at birth and never told of the other one? How was this the deal that the demented parent came up with? Still, whether it's the original or the remake, <a href="https://www.cinemablend.com/movies/i-decided-to-rewatch-the-parent-trap-and-i-appreciate-these-things-more-as-an-adult">everyone loves the movies</a>, including me. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="DLzzRfnN6iqCUvYC2UxT5C" name="jenniferlopezralphfiennesmaidinmanhattan" alt="Marisa Ventura (Jennifer Lopez) and Christopher "Chris" Marshall (Ralph Fiennes) reintroduce themselves in Maid in Manhattan" src="https://cdn.mos.cms.futurecdn.net/DLzzRfnN6iqCUvYC2UxT5C.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Sony Pictures Releasing)</span></figcaption></figure><h2 id="maid-in-manhattan">Maid In Manhattan</h2><p>The Jennifer Lopez hit <em>Maid in Manhattan</em> is one of the trope-ier movies on this list. It kind of checks all the boxes for a standard rom-com, yet somehow it is still incredibly fun. Lopez plays a single mom trying to make it in the big city and... well... there's a rich guy, and yadda yadda yadda. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="2jYCwjfXrKQk2apXEgQe3R" name="GAG_305_Unit_00601RC" alt="Brianne Howey and Antonia Gentry in Ginny & Georgia Season 3." src="https://cdn.mos.cms.futurecdn.net/2jYCwjfXrKQk2apXEgQe3R.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="ginny-and-georgia">Ginny And Georgia</h2><p>Almost immediately, <em>Ginny & Georgia</em> drew <a href="https://www.cinemablend.com/streaming-news/ginny-and-georgia-is-better-than-the-gilmore-girls-and-i-dont-care-who-in-stars-hollow-knows-it">comparisons to <em>The Gilmore Girls</em></a>, and it's easy to see why. The dynamic between teen daughter Ginny and her mother, Georgia, is very similar to the one between Rory and Lorelai.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="n9Ahx3hfPSNnBJWLUFK7SK" name="Reba McEntire Netflix.jpg" alt="Reba McEntire in the series finale of Reba." src="https://cdn.mos.cms.futurecdn.net/n9Ahx3hfPSNnBJWLUFK7SK.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="reba">Reba</h2><p>Not only was <em>Reba</em> one of the best shows set in the South, it also firmly belongs on this list as a great show about a single parent. The show stars Country music icon Reba McEntire as a mother of three whose husband leaves her for a younger woman, and she is left to pick up the pieces. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="gZ2SyyQtjzKn5TknN2QPeB" name="Panic Room 1.jpg" alt="Jodie Foster and Kristen Stewart in Panic Room" src="https://cdn.mos.cms.futurecdn.net/gZ2SyyQtjzKn5TknN2QPeB.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Columbia Pictures)</span></figcaption></figure><h2 id="panic-room">Panic Room</h2><p>One of the more underrated <a href="https://www.cinemablend.com/movies/i-watched-david-finchers-filmography-i-have-a-new-favorite">David Fincher movies</a>, <em>Panic Room</em> is a true thriller about a mother and daughter. Jodie Foster plays a mother who moves into a new house with her young daughter after a divorce. On their first night in the new (very nice) brownstone, some burglars break in. Luckily, there's a panic room! Okay, it doesn't sound great when you break it down like that, but like most of Fincher's movies, it's actually pretty great. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="P75w3a6z8vyPLVpzExYJVd" name="lauren graham parenthood" alt="lauren graham on parenthood" src="https://cdn.mos.cms.futurecdn.net/P75w3a6z8vyPLVpzExYJVd.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="parenthood">Parenthood</h2><p>While it's loosely based on the 1989 movie of the same name, the television show <em>Parenthood </em>is quite a bit different from the movie. On the show, Lauren Graham plays Sarah, the single mother of two working on a bartender's salary. There are other parents, of course, Sarah's siblings, who aren't single, but Lauren's story is key to the show. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="8c7icsMCkD6jvncXnfZMhM" name="onedayatatimecast.jpg" alt="Ann and Julie Romano have a discussion on One Day at a Time" src="https://cdn.mos.cms.futurecdn.net/8c7icsMCkD6jvncXnfZMhM.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: T.A.T. Communications Company)</span></figcaption></figure><h2 id="one-day-at-a-time">One Day At A Time</h2><p><em>One Day At A Time</em>, which was later rebooted in the 2010s, starred Bonnie Franklin as a single mother struggling to raise her teenage daughters in a small apartment in Indianapolis. It was a cornerstone show for anyone who grew up in the '70s and '80s, as it was a staple of reruns in syndication after its nine-season run on CBS.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="39pQkaQJFuHx2PQChYWfCe" name="Candace-Cameron-Bure-candace-cameron-bure-bob-saget-tribute085_.jpg" alt="Bob Saget and Candace Cameron Bure on Full House" src="https://cdn.mos.cms.futurecdn.net/39pQkaQJFuHx2PQChYWfCe.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros. Television)</span></figcaption></figure><h2 id="full-house">Full House</h2><p>Well, you <em>knew</em> I had to include <em>Full House</em> on this show. Even though I was personally a little too old to get into this show when it was on, I certainly recognize the cultural impact of the Tanner family and the stars that this show produced, including Bob Saget as Danny Tanner, the widowed father of DJ, Stephanie, and Michelle. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="tEvK54kJ6r3jTE6o6h3azY" name="one fine day 20th century fox.png" alt="george clooney and michelle pfeiffer in one fine day" src="https://cdn.mos.cms.futurecdn.net/tEvK54kJ6r3jTE6o6h3azY.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: 20th Century Fox)</span></figcaption></figure><h2 id="one-fine-day">One Fine Day</h2><p>Just when George Clooney was really becoming <em>George Clooney</em>, he starred in the rom-com <em>One Fine Day</em> alongside Michelle Pfeiffer. Pfeiffer plays a single mom struggling with her ex to raise their child. Enter Clooney's character, Jack, who is also recently divorced, and after a series of hijinks, the two end up finding love with each other. Yeah, it's as cheesy as it sounds, but Pfeiffer and Clooney make it work better than it should. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="YYwgUpHJw5RNehAQ8xD2vN" name="william h macy.jpg" alt="Frank with frazzled hair and beard on Shameless" src="https://cdn.mos.cms.futurecdn.net/YYwgUpHJw5RNehAQ8xD2vN.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Shameless on Showtime)</span></figcaption></figure><h2 id="shameless">Shameless</h2><p><em>Shameless</em> was never ashamed to show the dark side of a dysfunctional family, and no family in TV history has been as messed up as the Gallaghers. At the top of the heap of screwups is Frank, the hapless, drunk father played brilliantly by William H. Macy. You can't help but love this group of misfits. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="ugcGPCcqqznfbidNExy4GD" name="overboardkurtrussellgoldiehawn.jpg" alt="Kurt Russell and Goldie Hawn in Overboard" src="https://cdn.mos.cms.futurecdn.net/ugcGPCcqqznfbidNExy4GD.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: MGM)</span></figcaption></figure><h2 id="overboard">Overboard</h2><p>One of the most enduring relationships in Hollywood is the one between Kurt Russell and Goldie Hawn. In the '80s, they teamed up a few times, and one of the best has to be <em>Overboard</em>. Hawn plays a snobby, rich woman with amnesia, and Russell plays a working-class guy who is raising his kids on his own. He devises a plan (that is quite disturbing in hindsight) to trick Hawn into living with the family. Hilarity ensues. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="v5opHJzMAYPS8axZisYLxn" name="andy griffith show" alt="Opie Aunt Bee and Andy Taylor in the kitchen on The Andy Griffith show." src="https://cdn.mos.cms.futurecdn.net/v5opHJzMAYPS8axZisYLxn.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="the-andy-griffith-show">The Andy Griffith Show</h2><p><em>The Andy Griffith Show</em> is the <a href="https://www.cinemablend.com/television/famous-tv-shows-set-in-the-american-south">quintessential show based in the South</a>, and it's easy to forget, unless you watched it, that Andy was a single father raising Opie (Ron Howard). Sure, he had Aunt Bee (Frances Bavier) there to help out, but he was a single dad, and that was pretty rare on TV in the '60s. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="jvgDSei4aZJFGrbmNiV7ec" name="no reservations.jpg" alt="Catherine Zeta-Jones, Abigail Breslin, and Aaron Eckhart in No Reservations" src="https://cdn.mos.cms.futurecdn.net/jvgDSei4aZJFGrbmNiV7ec.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros.)</span></figcaption></figure><h2 id="no-reservations">No Reservations</h2><p>Yet another rom-com on this list, <em>No Reservations</em>, is about Kate, a hard-charging chef played by Catherine Zeta-Jones, who becomes guardian for her niece (Abigail Breslin) when her sister is killed in a car crash. She finds a way through her grief with a new sous chef who threatens her job, but opens up her heart, played by Aaron Eckhart.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="rRBvfhSKMV3VG8J6UaZgNX" name="my three sons.png" alt="the stars of my three sons" src="https://cdn.mos.cms.futurecdn.net/rRBvfhSKMV3VG8J6UaZgNX.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="my-three-sons">My Three Sons</h2><p>One of the earliest examples of a TV show about a single parent is the 1960s classic <em>My Three Sons</em>, starring Fred MacMurray as a single dad with, you guessed it, three sons. It's all right there in the title! </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="69RaEx4gkfMMBjaeHpnd9N" name="mommiedearestfaye" alt="Faye Dunaway in Mommie Dearest" src="https://cdn.mos.cms.futurecdn.net/69RaEx4gkfMMBjaeHpnd9N.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Paramount)</span></figcaption></figure><h2 id="mommie-dearest">Mommie Dearest</h2><p>When I was a kid, my mom loved to make fun of Joan Crawford (hey, it was a thing), and that was in large part due to this movie, <em>Mommie Dearest</em>. While the movie hasn't held up, it certainly tells a disturbing story of a single mom (Crawford, played by Faye Dunaway), raising her two kids in terror. I watched it too many times as a kid, and I still hate wire hangers. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="yTpbSLD3yRaaTTFEEiexvQ" name="whosthebossjudithlight.jpg" alt="Judith Light on Who's the Boss?" src="https://cdn.mos.cms.futurecdn.net/yTpbSLD3yRaaTTFEEiexvQ.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="who-s-the-boss">Who's The Boss?</h2><p>There isn't just one single parent in <em>Who's The Boss?,</em> there are two.  Tony Danza plays...Tony, a single father to Sam (Alyssa Milano), who becomes a live-in maid for Angela (Judith Light,) who is helped by her mother Mona (Katherine Helmond) in raising her son Jonathan (Danny Pintauro). It may not be one of the <a href="https://www.cinemablend.com/television/100-best-tv-sitcoms-of-all-time-ranked">best sitcoms ever</a>, but it's a classic show for anyone in Gen X.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="GcPRBGMEm4RRdTu8dQhYUe" name="witherspook.jpg" alt="Reese Witherspoon in Big Little Lies" src="https://cdn.mos.cms.futurecdn.net/GcPRBGMEm4RRdTu8dQhYUe.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO)</span></figcaption></figure><h2 id="big-little-lies">Big Little Lies</h2><p><em>Big Little Lies</em> is filled with complicated family dynamics, including Shailene Woodley as a single mom to Ziggy (Iain Armitage).</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="XwDjtsP4f7ZZTFmiu5taD6" name="Screen Shot 2023-09-20 at 5.45.26 PM.jpg" alt="Matt Damon in We Bought a Zoo" src="https://cdn.mos.cms.futurecdn.net/XwDjtsP4f7ZZTFmiu5taD6.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: 20th Century Studios)</span></figcaption></figure><h2 id="we-bought-a-zoo">We Bought A Zoo</h2><p>I simply had to include this one. Most people don't really like the Matt Damon movie <em>We Bought A Zoo</em>, but I must have been in just the right mood for it's syrupy sweet vibe when I first saw, so I love it. It's not the best movie on this list, but I really do find it cute. And like every other movie and TV show on this list, it's about a single parent! </p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ Candace Cameron Bure Celebrates 38 Years Of Full House (And Dave Coulier Responded) ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/candace-cameron-bure-celebrates-38-years-full-house-dave-coulier-responded</link>
                                                                            <description>
                            <![CDATA[ Oof, that's a tearjerker. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">MyFyYqc5KDLhL9JdcPppZG</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/9Uxu4MMvuew9jJW9yLvH5f-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Tue, 23 Sep 2025 18:58:04 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Heidi Venable ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/w7HQ9MvRSDd7diNpTmruW9.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Heidi Venable is a Content Producer for CinemaBlend. She started freelancing for the site in 2020 and officially came on board in 2021. Her job entails writing news stories and TV reactions from some of her favorite prime-time shows like Grey&#039;s Anatomy and The Bachelor. She graduated from Louisiana Tech University with a degree in Journalism and worked in the newspaper industry for almost two decades in multiple roles including Sports Editor, Page Designer and Online Editor.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Into&lt;/strong&gt;: Heidi grew up in the 1990s, and her tastes strongly reflect that. She can (and does) quote Friends constantly, enjoys a good West Wing binge, thinks Can&#039;t Hardly Wait was the most influential movie of her life and finds solace in 311 concerts. On Sundays during football season, she can be found cheering on the New Orleans Saints with her husband and two daughters. Who Dat! She loves to read but usually settles for a pop culture podcast, and thinks the best weekends are spent cooking and playing cards with friends and family, preferably with some UFC fights or other sporting event on TV.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Excited About Right Now&lt;/strong&gt;: Football season, Pumpkin Spice Lattes and everything related to fall and cooler weather. The Game of Roses podcast and all things The Bachelor, and new episodes of Grey&#039;s Anatomy, Love Is Blind, The Voice, OMITB and more.&amp;nbsp;&lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/9Uxu4MMvuew9jJW9yLvH5f-1280-80.jpg">
                                                            <media:credit><![CDATA[Micahel Yarish/Netflix]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Candace Cameron Bure as DJ looks at Dave Coulier as Joey on Fuller House.]]></media:description>                                                            <media:text><![CDATA[Candace Cameron Bure as DJ looks at Dave Coulier as Joey on Fuller House.]]></media:text>
                                <media:title type="plain"><![CDATA[Candace Cameron Bure as DJ looks at Dave Coulier as Joey on Fuller House.]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/9Uxu4MMvuew9jJW9yLvH5f-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>If you grew up with the Tanner family on <em>Full House</em>, my sincerest apologies, because this bit of news from Candace Cameron Bure might make you feel a bit old (it certainly did for me). This week marks the 38th anniversary of the <a href="https://www.cinemablend.com/television/10-Greatest-TGIF-Comedies-All-Time-Ranked-120697.html">beloved TGIF comedy</a>’s premiere on ABC. That’s right, just shy of four decades, and to celebrate another year gone by, Bure shared a ton of throwback pics and videos that admittedly brought a tear to my eye.</p><p>On September 22, 1987, America was introduced to widower Danny Tanner (Bob Saget), his three daughters and the two guys who were moving in to help following the death of Danny’s wife. The rest was history, as we watched DJ, Stephanie and Michelle (Candace Cameron Bure, Jodie Sweetin and the Olsen twins, respectively) <a href="https://www.cinemablend.com/television/candace-cameron-bure-rare-comment-about-mary-kate-ashley-olsen-how-they-contributed-full-houses-success">grow up before our eyes</a> for the next eight years. Bure posted some great memories to <a href="https://www.instagram.com/p/DO6SUWwEfIo/?hl=en&img_index=1">Instagram</a> to mark the occasion, which you can see below:</p><div class="instagram-embed"><blockquote class="instagram-media"  data-instgrm-version="6" style="width:99.375%; width:-webkit-calc(100% - 2px); width:calc(100% - 2px);"><p><a href="https://www.instagram.com/p/DO6SUWwEfIo/" target="_blank">A post shared by Candace Cameron Bure (@candacecbure)</a></p><p>A photo posted by  on </p></blockquote></div><p>From Tanner family portraits to candid shots of the cast members hanging out together off-set to that <a href="https://www.cinemablend.com/television/retro-tv-theme-songs-that-still-slap">theme song that still slaps</a>, Candace Cameron Bure provides quite the amazing walk down memory lane, pulling out her character’s catchphrase in her caption, which read:</p><div><blockquote><p>38 years since we first met the Tanners?? Oh, Mylanta!!🤯 What a beautiful journey filled with laughter, lessons, and lots and lots of love…🥹❤️ Full House was my childhood, my family, my home. Forever grateful.🙏🏼🏡</p></blockquote></div><p>Another person who’s grateful for the memories and for the family he met on the <em>Full House</em> set is Dave Coulier, aka Joey Gladstone (but <a href="https://www.cinemablend.com/television/jodie-sweetin-clarified-common-full-house-misconception-mind-blown">not Uncle Joey</a>?). The comedian responded with an adorable message in the comments. He wrote:</p><div><blockquote><p>My family that I will love forever❤️❤️❤️❤️❤️❤️</p></blockquote></div><p>There’s no arguing that this fictional family became a real one over those eight years, with the cast staying in touch — despite some <a href="https://www.cinemablend.com/television/after-candace-cameron-bures-alleged-beef-with-jodie-sweetin-she-and-full-house-co-star-discuss-how-cast-tends-to-bicker-like-a-family">bickering between the co-stars</a> at times — and ultimately reuniting for the spinoff <em>Fuller House</em> in 2016 (which can be streamed with a <a href="https://www.cinemablend.com/streaming-news/netflix-subscription-the-plans-the-price-and-whats-included">Netflix subscription</a>).</p><p>The actors look so much like family in the pics above that the only way you can tell the show photos from their personal ones is by looking at which pictures feature both Mary-Kate and Ashley Olsen, as opposed to just one “Michelle Tanner.”</p><p>John Stamos (Uncle Jesse) and Lori Loughlin (Aunt Becky) are seen in quite a few shots, as are Andrea Barber (Kimmy Gibbler), Scott Weinger (Steve Hale), and Blake and Dylan Tuomy-Wilhoit, who played twins Nicky and Alex. It looks like Loughlin and Candace Cameron Bure were pretty close, and I love that they seem to have shared the same bond as their characters did. </p><p>The final slide of Candace Cameron Bure’s post, however, nearly did me in, as it showed the actress years ago receiving a surprise message from Bob Saget, who <a href="https://www.cinemablend.com/television/bob-sagets-cause-of-death-determined-to-be-head-trauma">has since passed away</a>. In a pre-recorded video, he tells his TV daughter:</p><div><blockquote><p>Something I’ve always loved about you, and always will, is how you’ve been such a great friend, so supportive and helped me through some really difficult times. And also helped me through work stuff. Like, I never knew my lines, and even when you were 9 years old, you would tell me my dialogue. I’ll always be indebted to that. On Fuller House, same thing. You had to help me out there, tell me where to stand. So I really appreciate that, and I just love you.</p></blockquote></div><p>OK, I’m not the only one crying, right? You can <a href="https://www.cinemablend.com/streaming-news/bob-saget-what-to-watch-to-remember-the-beloved-comedy-actor">pay homage to Bob Saget</a> and the rest of the cast of the 38-year-old family sitcom by streaming <a href="https://www.cinemablend.com/television/2553472/full-house-best-episodes-ranked"><em>Full House</em>’s best episodes</a> (or the <a href="https://www.cinemablend.com/television/full-houses-jodie-sweetin-and-andrea-barber-cant-stand-one-of-earliest-episodes">worst one</a>, as agreed upon by Jodie Sweetin and Andrea Barber), with all eight seasons available to stream with a <a href="https://www.cinemablend.com/television/2570844/subscribing-to-hulu-the-price-whats-included-and-everything-else-to-know">Hulu subscription</a>.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ 32 Fictional TV Hosts We Wish Were Real  ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/movies/fictional-tv-hosts-we-wish-were-real</link>
                                                                            <description>
                            <![CDATA[ And, we're back... ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">7W74nY5fxL8uVYRbRXu8nU</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/dytuxPJuAUJNk6uNLK2yT8-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Tue, 29 Jul 2025 15:31:00 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Movies]]></category>
                                                                                                                    <dc:creator><![CDATA[ Jason Wiese ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/62SRu9Bi2SyJGrpzKXAfsK.jpg ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Jason Wiese writes feature stories for CinemaBlend. His occupation results from years dreaming of a filmmaking career, settling on a &quot;professional film fan&quot; career, studying journalism at Lindenwood University in St. Charles, MO (where he served as Culture Editor for its student-run print and online publications), and a brief stint of reviewing movies for fun. He would later continue that side-hustle of film criticism on TikTok (@wiesewisdom), where he posts videos on a semi-weekly basis.&lt;/p&gt;&lt;p&gt;&lt;br&gt;&lt;/p&gt;&lt;p&gt;Jason has been writing since he was able to pick up a washable marker, with which he wrote his debut illustrated children&#039;s story, later transitioning to a short-lived comic book series and (very) amateur filmmaking before finally settling on pursuing a career in writing about movies in lieu of making them. Look for his name in almost any article about Batman.&lt;/p&gt;&lt;p&gt;&lt;br&gt;&lt;/p&gt;&lt;p&gt;&lt;strong&gt;What He&#039;s Into&lt;/strong&gt;: Readers may notice a recurring theme of horror and superhero-related content (especially in regards to Batman) in much of Jason&#039;s work, but his favorite film of all time is more in line with traditional action/adventure stories: &lt;em&gt;Raiders of the Lost Ark&lt;/em&gt;. His favorite TV series is the gritty, grounded crime thriller &lt;em&gt;Breaking Bad&lt;/em&gt; and if you catching him reading anything, it is probably a comic book (and, more often than not, one featuring Batman). More important to him than entertainment, however, are his wife and two dogs.&lt;/p&gt;&lt;p&gt;&lt;br&gt;&lt;/p&gt;&lt;p&gt;&lt;strong&gt;What He&#039;s Excited About Right Now&lt;/strong&gt;: Jason typically tries to keep his excitement and expectations for any upcoming movies as low as possible, but he is certainly looking forward to returning to Matt Reeves&#039; vision of Gotham City in the upcoming follow-up to &lt;em&gt;The Batman&lt;/em&gt; and just about any horror movie set to haunt cinemas soon.&lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/dytuxPJuAUJNk6uNLK2yT8-1280-80.jpg">
                                                            <media:credit><![CDATA[HBO]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Garry Shandling on The Larry Sanders Show]]></media:description>                                                            <media:text><![CDATA[Garry Shandling on The Larry Sanders Show]]></media:text>
                                <media:title type="plain"><![CDATA[Garry Shandling on The Larry Sanders Show]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/dytuxPJuAUJNk6uNLK2yT8-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>As a student of journalism, a lifelong avid TV watcher, and a fan of <a href="https://www.cinemablend.com/television/2475790/ranking-stephen-colbert-jimmy-fallon-jimmy-kimmel-and-all-the-other-current-late-night-hosts">late-night TV hosts</a>, I have always been fascinated by the way television personalities are depicted in fiction. Sometimes these characters represent the best that the media can offer, while others serve as a mockery of the profession. Either way, I can’t get enough of them, and these are some of my favorites.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="W3bmEJjQDCxSSZSpEV94NK" name="Anchorman The Legend of Ron Burgundy Will Ferrell smiles confidently at the news desk.jpg" alt="Will Ferrell smiles confidently at the news desk in Anchorman The Legend of Ron Burgundy." src="https://cdn.mos.cms.futurecdn.net/W3bmEJjQDCxSSZSpEV94NK.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: DreamWorks Pictures)</span></figcaption></figure><h2 id="ron-burgundy-anchorman-the-legend-of-ron-burgundy">Ron Burgundy (Anchorman: The Legend Of Ron Burgundy)</h2><p>Most would agree that the <a href="https://www.cinemablend.com/new/15-Best-Ferrell-Characters-Ranked-70446.html">best Will Ferrell character</a> has to be the title role of his 2004 favorite, <em>Anchorman: The Legend of Ron Burgundy</em>. The former <em>SNL</em> star actually gave the world a taste of what it would be like if the charismatic, scotch-loving teleprompter loyalist were a real person when he hosted <a href="https://www.iheart.com/podcast/1119-the-ron-burgundy-podcast-30270227/"><em>The Ron Burgundy Podcast</em></a>.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="ZufS5wSjtGxattLAvNq5BS" name="Jean_Smart_Hacks_2.jpg" alt="Jean Smart in Season 3 of Hacks on HBO Max." src="https://cdn.mos.cms.futurecdn.net/ZufS5wSjtGxattLAvNq5BS.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO )</span></figcaption></figure><h2 id="deborah-vance-hacks">Deborah Vance (Hacks)</h2><p>Jean Smart has won multiple Emmys for her role in the HBO Max original comedy series, <em>Hacks</em>, as Deborah Vance, the host of <em>Late Night</em> and a hilarious, pitch-perfect representation of the business' intense, cutthroat nature.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="MCW3868zU8ENLPFqYCY6wJ" name="alanpartridgealphapapastevecoogan" alt="Steve Coogan in a recording studio in Alan Partridge: Alpha Papa" src="https://cdn.mos.cms.futurecdn.net/MCW3868zU8ENLPFqYCY6wJ.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: StudioCanal)</span></figcaption></figure><h2 id="alan-partridge-various">Alan Partridge (Various)</h2><p>Steve Coogan has portrayed Alan Partridge, the uproariously inept British TV personality he created with Armando Iannucci, in various projects. He debuted on the BBC radio program <em>On the Hour</em>, received his own mockumentary-style chat show <em>Knowing Me, Knowing You with Alan Partridge</em>, led a sitcom called <em>I'm Alan Partridge</em>, and was the focus of a 2013 feature film called <em>Alan Partridge: Alpha Papa</em>, in which he is forced to be a hostage negotiator.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="KGJdpMmfaWC6xFa3FELkNN" name="murphy brown.png" alt="candice bergen on murphy brown" src="https://cdn.mos.cms.futurecdn.net/KGJdpMmfaWC6xFa3FELkNN.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="murphy-brown-murphy-brown">Murphy Brown (Murphy Brown)</h2><p>The eponymous lead character from the long-running, beloved sitcom, <em>Murphy Brown</em>, is not only one of multi-Emmy-winning Candice Bergen's most iconic characters, but one of the most influential fictional female figures in news media, depicted as a trailblazer in her profession.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="zcZTPxc6wLwohw7cWomqhg" name="Network Peter Finch stands in the newsroom looking mad as hell.jpg" alt="Peter Finch stands in the newsroom, looking mad as hell, in Network." src="https://cdn.mos.cms.futurecdn.net/zcZTPxc6wLwohw7cWomqhg.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros.)</span></figcaption></figure><h2 id="howard-beale-network">Howard Beale (Network)</h2><p>Originally released in 1976, <a href="https://www.cinemablend.com/movies/rewatched-network-disturbing-just-how-relevant-it-still-is-but-thats-not-all-took-away-from-it-this-time"><em>Network</em> remains a disturbingly relevant commentary</a> on news media and society in general, with much credit due to Peter Finch's bold, Oscar-winning performance as Howard Beale. That being said, you rarely hear of a broadcast journalist being as boldly direct and brutally honest about their feelings as he is these days.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="hc7X9V8dida4GZjEqt4xtd" name="Screen Shot 2022-08-16 at 10.19.40 AM.png" alt="Courteney Cox in Scream (2022)" src="https://cdn.mos.cms.futurecdn.net/hc7X9V8dida4GZjEqt4xtd.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Paramount Pictures)</span></figcaption></figure><h2 id="gale-weathers-scream">Gale Weathers (Scream)</h2><p>In 1996's <a href="https://www.cinemablend.com/movies/best-slasher-horror-movies-and-how-to-watch">slasher movie favorite</a>, <em>Scream</em>, Gale Weathers (Courteney Cox) was your typical sleazy, self-serving gossip reporter, but would slowly evolve into a professional with some tact in the sequels. Not to mention, few people in her field can claim to have the kind of first-hand experience with the deadly topics she discusses, having survived several <a href="https://www.cinemablend.com/movies/the-scream-movies-the-villains-behind-every-ghostface-so-far">Ghostface killers</a> over the years.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="URFQXrD85CsgRMJLeoFtsD" name="mikemyerssnlmonkeyfly.jpg" alt="Mike Myers and Dana Carvey on SNL" src="https://cdn.mos.cms.futurecdn.net/URFQXrD85CsgRMJLeoFtsD.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="wayne-campbell-and-garth-algar-wayne-s-world">Wayne Campbell And Garth Algar (Wayne's World)</h2><p>Local cable access television had never been as cool (or cool at all, really) before Mike Myers and Dana Carvey debuted as Wayne Campbell and Garth Algar, who later became the stars of two <a href="https://www.cinemablend.com/streaming-news/every-movie-based-on-snl-characters-ranked">beloved movies based on the <em>Saturday Night Live</em> sketch</a> from which they originated.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="h6DpCVyAxAXYmxGqyCsczA" name="White-1 (1).jpg" alt="Betty White on the Mary Tyler Moore Show." src="https://cdn.mos.cms.futurecdn.net/h6DpCVyAxAXYmxGqyCsczA.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="sue-ann-nivens-the-mary-tyler-moore-show">Sue Ann Nivens (The Mary Tyler Moore Show)</h2><p>Betty White was brilliant on <em>The Mary Tyler Moore Show</em> as Sue Ann Nivens, balancing her perky, kindly on-camera persona as host of <em>The Happy Homemaker</em> with her vindictive and highly competitive off-screen personality with incredible ease.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="2QhS4D5LYcX9s5FTpjiEeA" name="himymrobinnews" alt="Cobie Smulders as Robin Scherbatsky delivering the news on How I Met Your Mother" src="https://cdn.mos.cms.futurecdn.net/2QhS4D5LYcX9s5FTpjiEeA.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="robin-scherbatsky-how-i-met-your-mother">Robin Scherbatsky (How I Met Your Mother)</h2><p>Robin Scherbatsky, <a href="https://www.cinemablend.com/television/2474932/how-i-met-your-mother-whats-the-cast-up-to-now"><em>How I Met Your Mother</em> cast</a> member Cobie Smulders' role on the hit sitcom, is a real go-getter in the world of broadcast journalism. She always opted to put her career before everything else, even if it cost her a few chances in the department of romance. At least, that was the case in earlier seasons.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="VsqEE6VDVoSqHT8ts8ykTK" name="larrysanderswince" alt="Garry Shandling on The Larry Sanders Show" src="https://cdn.mos.cms.futurecdn.net/VsqEE6VDVoSqHT8ts8ykTK.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO)</span></figcaption></figure><h2 id="larry-sanders-the-larry-sanders-show">Larry Sanders (The Larry Sanders Show)</h2><p>During its run from 1992 to 1998 on HBO, few comedy series had a sharper satirical outlook on show business than the Emmy-winning <em>The Larry Sanders Show</em>. Co-creator Garry Shandling starred as the titular late-night talk show host, who is constantly at odds with behind-the-scenes shenanigans courtesy of staff members and <a href="https://www.cinemablend.com/movies/hilarious-times-where-celebrities-played-wildly-exaggerated-versions-of-themselves">celebrities playing wild versions of themselves</a>.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="yC5cf38D2PtUtMGybrPvzg" name="jokermurray" alt="Robert De Niro in Joker" src="https://cdn.mos.cms.futurecdn.net/yC5cf38D2PtUtMGybrPvzg.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros. / DC)</span></figcaption></figure><h2 id="murray-franklin-joker">Murray Franklin (Joker)</h2><p>It is fitting that Robert De Niro stars in a DC Comics adaptation that heavily borrows from some of his grittiest roles, especially <em>Taxi Driver</em>'s Travis Bickle. The acting legend appears in 2019's <em>Joker</em> opposite Joaquin Phoenix's Academy Award-winning role of Arthur Fleck as Murray Franklin, the host of the Gotham-based late-night program, <em>Live!</em>, who might not have survived the airwaves today with his meanspiritedness. Yet, I can't help but respect his bold approach to humor and showcasing risque topics.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="ygpi6W8cCyREkS33ktiriY" name="Kent quote" alt="Kent Brockman smiling at the camera and wearing a green suit" src="https://cdn.mos.cms.futurecdn.net/ygpi6W8cCyREkS33ktiriY.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="kent-brockman-the-simpsons">Kent Brockman (The Simpsons)</h2><p>One of Harry Shearer's funniest characters on <em>The Simpsons</em> is Kent Brockman, a Springfield-based TV editorialist who has no filter when it comes to sounding off his typically judgmental opinions.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Jq9HMvJkqQa8Tm69Ndu4pb" name="anchorman ron and veronica on news" alt="Will Ferrell and Christina Applegate sitting next to each other at the new desk." src="https://cdn.mos.cms.futurecdn.net/Jq9HMvJkqQa8Tm69Ndu4pb.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: DreamWorks)</span></figcaption></figure><h2 id="veronica-corningstone-anchorman-the-legend-of-ron-burgundy">Veronica Corningstone (Anchorman: The Legend Of Ron Burgundy)</h2><p>If <em>Anchorman: The Legend of Ron Burgundy</em> actually was inspired by a true story, as it (sort of) claims at the very beginning, Veronica Corningstone (Christina Applegate) would have undoubtedly gone down in history as one of the most important figures of women's progress in the world of broadcast news.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="JYnYNUSgrphacWU6xsKPzn" name="Untitled design (8).jpg" alt="David Dastmalchian as Jack Delroy in Late Night with the Devil." src="https://cdn.mos.cms.futurecdn.net/JYnYNUSgrphacWU6xsKPzn.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: IFC Films/Shudder)</span></figcaption></figure><h2 id="jack-delroy-late-night-with-the-devil">Jack Delroy (Late Night With The Devil)</h2><p>David Dastmalchian gives one of his career-best performances as infamous TV legend <a href="https://www.cinemablend.com/interviews/does-late-night-with-the-devil-jack-delroy-believe-supernatural-david-dastmalchian-digs-mind-talk-show-host">Jack Delroy, who has a life-changing brush with the supernatural</a> in <em>Late Night with the Devil</em>. I imagine I would have been a fan of the <em>Nite Owls</em> host, at least right up until the night he brings his program to a screeching halt by conjuring a demonic spirit during a live broadcast on Halloween 1977.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="zEiMBvvTCH2rqiAdt3dLHc" name="The Running Man 2" alt="Richard Dawson throwing out his arms in The Running Man" src="https://cdn.mos.cms.futurecdn.net/zEiMBvvTCH2rqiAdt3dLHc.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Tri-Star Pictures)</span></figcaption></figure><h2 id="damon-killian-the-running-man">Damon Killian (The Running Man)</h2><p>I believe the eponymous, deadly reality competition show from the <a href="https://www.cinemablend.com/news/2572453/adapting-stephen-king-the-running-man-arnold-schwarzenegger-movie-least-stephen-king-film">1987 adaptation of Stephen King's dystopian novel, <em>The Running Man</em></a>, is abhorrent, and I pray it never becomes a reality. However, one thing I can commend it for is hiring a host as charismatic and enthusiastic as Damon Killian, played by former <a href="https://www.cinemablend.com/television/2475953/ranking-all-the-family-feud-hosts-from-richard-dawson-to-steve-harvey"><em>Family Feud</em> emcee</a> Richard Dawson.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="GHjXrQqAXc22Ljsws3u9zf" name="newsroomjeffdaniels" alt="Jeff Daniels on The Newsroom" src="https://cdn.mos.cms.futurecdn.net/GHjXrQqAXc22Ljsws3u9zf.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO)</span></figcaption></figure><h2 id="will-mcavoy-the-newsroom">Will McAvoy (The Newsroom)</h2><p>Jeff Daniels' Emmy-winning role as Will McAvoy on creator Aaron Sorkin's <em>The Newsroom</em> had the courage to call out dishonesty and corruption when few others would dare, which is a quality more TV journalists in the real world could certainly benefit from.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="P9CBBsPiEqeRo7AZdRxFTY" name="Carvey" alt="Dana Carvey smiles at the camera while playing The Church Lady on SNL." src="https://cdn.mos.cms.futurecdn.net/P9CBBsPiEqeRo7AZdRxFTY.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC/ Saturday Night Live)</span></figcaption></figure><h2 id="enid-the-church-lady-strict-saturday-night-live">Enid "The Church Lady" Strict (Saturday Night Live)</h2><p>Dana Carvey is the actor behind a few of the <a href="https://www.cinemablend.com/television/funniest-reoccurring-characters-saturday-night-live">funniest recurring <em>Saturday Night Live</em> characters</a>, including, arguably, his signature role as Enid "The Church Lady" Strict. No matter how many times she uttered her signature catchphrases, the host of a faith-based talk show called <em>Church Chat</em>, which was mainly devoted to accusing her guests of worshipping Satan, was always a joy to laugh at, which certainly makes her "special."</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="jBgt8NuNN4FsttKcF49XtT" name="conanspaceghost.jpg" alt="Space Ghost talking to Conan O'Brien" src="https://cdn.mos.cms.futurecdn.net/jBgt8NuNN4FsttKcF49XtT.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Adult Swim)</span></figcaption></figure><h2 id="space-ghost-space-ghost-coast-to-coast">Space Ghost (Space Ghost Coast To Coast)</h2><p>Making a relatively obscure Hanna-Barbera cartoon character the host of his own talk show, featuring real-life celebrity guests, is a pretty random idea, I will admit. That being said, how cool would it be if a superhero actually did broadcast a talk show from outer space, like on <em>Space Ghost Coast to Coast</em>?</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="UKi3E6LVc2Xg2JAHYQPJr" name="latenightthompson" alt="Late Night with Emma Thompson" src="https://cdn.mos.cms.futurecdn.net/UKi3E6LVc2Xg2JAHYQPJr.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Amazon Studio)</span></figcaption></figure><h2 id="katherine-newbury-late-night">Katherine Newbury (Late Night)</h2><p>The 2019 comedy film <em>Late Night</em> takes audiences behind the scenes of the world of late-night TV, focusing on the unlikely bond between the eponymous host of <em>Tonight with Katherine Newbury</em>, played by Emma Thompson, and one of her writers, Molly Patel (Mindy Kaling).</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="9DvqZcicCiYStDvTaBhuiP" name="parksandrecperd" alt="Jay Jackson as Perd Hapley on Parks and Recreation" src="https://cdn.mos.cms.futurecdn.net/9DvqZcicCiYStDvTaBhuiP.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="perd-hapley-parks-and-recreation">Perd Hapley (Parks And Recreation)</h2><p>A <a href="https://www.cinemablend.com/television/Parks-Recreation-30-Greatest-Random-Pawnee-Side-Characters-70267.html"><em>Parks and Recreation</em> side character</a> whom I cannot get enough of is Perd Hapley (Jay Jackson), the host of the brilliantly titled program, <em>Ya Heard? with Perd. </em>I would watch the Pawnee, Indiana-based, hilariously matter-of-fact broadcaster religiously if his show were real.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="dfWPK53FWuMXkEgVL7j7Lm" name="vstephenfry" alt="Stephen Fry as Gordon Deitrich in V For Vendetta" src="https://cdn.mos.cms.futurecdn.net/dfWPK53FWuMXkEgVL7j7Lm.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros.)</span></figcaption></figure><h2 id="gordon-deitrich-v-for-vendetta">Gordon Deitrich (V For Vendetta)</h2><p>The 2005 adaptation of legendary comic book writer Alan Moore's dystopian graphic novel, <em>V for Vendetta</em>, is a deeply bleak story, but it does manage to maintain a few glimmers of hope in the form of characters like Gordon Deitrich. The comedian, played by Stephen Fry, is literally murdered for his willingness to mock the United Kingdom's fascist leader, Adam Sutler (John Hurt), on his satirical program.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="uUV7kHmcGNxTGuGH3k2FT8" name="Jennifer Aniston in The Morning Show" alt="Jennifer Aniston in The Morning Show" src="https://cdn.mos.cms.futurecdn.net/uUV7kHmcGNxTGuGH3k2FT8.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Apple TV+)</span></figcaption></figure><h2 id="alex-levy-the-morning-show">Alex Levy (The Morning Show)</h2><p>Jennifer Aniston would not be who she is if not for her role in the <a href="https://www.cinemablend.com/television/2474356/what-have-the-friends-cast-been-up-to-since-the-show-ended"><em>Friends</em> cast</a> as Rachel Green, but the actor has never quite given a performance as powerful as that of Alex Levy on the acclaimed <a href="https://www.cinemablend.com/television/2566890/the-best-apple-tv-shows-to-watch-including-ted-lasso">Apple TV+ original TV show</a>, <em>The Morning Show</em>. The consummate professional makes it a personal goal of hers to maintain control of the eponymous news program she has anchored for years when her share of the power over it begins to fall through the cracks.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="zvXZQXfY6WxH3upFpsQAC8" name="molshan.jpg" alt="Pat Dubek worried in The Other Two" src="https://cdn.mos.cms.futurecdn.net/zvXZQXfY6WxH3upFpsQAC8.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Max)</span></figcaption></figure><h2 id="pat-dubek-the-other-two">Pat Dubek (The Other Two)</h2><p>Molly Shannon's character on the Emmy-nominated Comedy Central series, <em>The Other Two</em>, makes her show, <em>Pat! The Pat Dubek Show,</em> a memorable experience with her endlessly upbeat demeanor and willingness to take phone calls from her children, including her world-famous pop star son, while on the air.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="WEK2ymXoSpF89Zq2WMQsUT" name="bojackwhale" alt="Keith Olbermann as Tom Jumbo-Grumbo from Bojack Horseman" src="https://cdn.mos.cms.futurecdn.net/WEK2ymXoSpF89Zq2WMQsUT.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="tom-jumbo-grumbo-bojack-horseman">Tom Jumbo-Grumbo (Bojack Horseman)</h2><p>One of the key elements that makes Netflix's show business satire <em>Bojack Horseman</em> one of the <a href="https://www.cinemablend.com/television/the-75-best-animated-TV-shows-of-all-time">best animated TV shows</a> of all time is the incredible line-up of surprising talents in the voice cast. For instance, former MSNBC commentator Keith Olbermann lends his voice to several episodes as a talking, anthropomorphic whale named Tom Jumbo-Grumbo, who is a host for the network MSNBSea.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="AQH3fq5r5dLopR74yR7dAc" name="kenan.jpg" alt="Kenan Thompson on Saturday Night Live" src="https://cdn.mos.cms.futurecdn.net/AQH3fq5r5dLopR74yR7dAc.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBCUniversal)</span></figcaption></figure><h2 id="diondre-cole-saturday-night-live">Diondre Cole (Saturday Night Live)</h2><p>There are many celebrities who have a good reason to be annoyed by Diondre Cole, the host of a unique BET discussion program called <em>What Up With That?</em>, especially former Fleetwood Mac guitarist Lindsey Buckingham (portrayed by Bill Hader). However, I personally cannot get enough of Kenan Thompson's hilarious recurring <em>Saturday Night Live</em> character and his unparalleled energy, no matter how terribly he struggles to conduct an interview without rudely interrupting his guests with another banging jam session.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="uHPhLusqp5KfNY52sc2reT" name="LoriLoughlinandBobSaget.jpg" alt="Lori Loughlin and Bob Saget on Full House" src="https://cdn.mos.cms.futurecdn.net/uHPhLusqp5KfNY52sc2reT.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Jeff Franklin Productions)</span></figcaption></figure><h2 id="danny-tanner-and-rebecca-donaldson-full-house">Danny Tanner And Rebecca Donaldson (Full House)</h2><p>At the beginning of the long-running family sitcom <em>Full House</em>, Bob Saget's character, widowed single father Danny Tanner, was introduced as a TV news reporter. In later seasons, he becomes the co-host of a local morning talk show called <em>Wake Up, San Francisco</em>, alongside Rebecca Donaldson (Lori Loughlin), who would eventually become his housemate when she marries his brother-in-law, Jesse (John Stamos).</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="xLmzoZz45RxyepdH4XzEe3" name="websterwithgeorge" alt="Webster and George on Webster" src="https://cdn.mos.cms.futurecdn.net/xLmzoZz45RxyepdH4XzEe3.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="george-papadopolis-webster">George Papadopolis (Webster)</h2><p>Alex Karras' character from the hit sitcom, <em>Webster</em>, in which he and his wife, Katherine (Susan Clark), become the guardians to their young godson (played by Emmanuel Lewis), must not have been much of a challenge for him to portray. Much like Karras himself, George Papadopolis was a former professional football player who went on to have a career in broadcasting.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="taLoWnQQc2t6nV6GffcYKZ" name="parksandreckarate" alt="Chris Pratt in Parks and Recreation" src="https://cdn.mos.cms.futurecdn.net/taLoWnQQc2t6nV6GffcYKZ.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="andy-johnny-karate-dwyer-parks-and-recreation">Andy "Johnny Karate" Dwyer (Parks And Recreation)</h2><p>In later seasons of NBC's beloved mockumentary sitcom, <em>Parks and Recreation,</em> Chris Pratt's character, Andy, becomes the host of his own children's program. His alter ego, Johnny Karate, is someone I think I would have loved to grow up with, and I probably would have shown him to my children as well.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Fje7LGDQwUtuaeciV7Z9m3" name="atlantamontague" alt="Alano Miller as Franklin Montague on Atlanta" src="https://cdn.mos.cms.futurecdn.net/Fje7LGDQwUtuaeciV7Z9m3.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: FX)</span></figcaption></figure><h2 id="franklin-montague-atlanta">Franklin Montague (Atlanta)</h2><p>One of the <a href="https://www.cinemablend.com/television/2547564/the-best-atlanta-episodes-ranked">best episodes of <em>Atlanta</em></a>, the clever, experimental, Emmy-winning "B.A.N.," is structured to appear as a snippet of programming from the eponymous network with a focus on Black audiences. Alano Miller guest stars as Franklin Montague, the host of his own self-titled talk show on B.A.N., who is clearly guilty of baiting his guests with combative rhetoric, but at least he manages to keep his show interesting.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="HnC9GxdhRq7t9HdtuYwdMM" name="rodneydangerfieldmeetwallysparks.jpg" alt="Rodney Dangerfield in Meet Wally Sparks" src="https://cdn.mos.cms.futurecdn.net/HnC9GxdhRq7t9HdtuYwdMM.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: TriMark Pictures)</span></figcaption></figure><h2 id="wally-sparks-meet-wally-sparks">Wally Sparks (Meet Wally Sparks)</h2><p>While 1997's <em>Meet Wally Sparks</em> is widely considered to be one of the weaker of comedian Rodney Dangerfield's films, it is still a Rodney Dangerfield movie, after all. If the title character, a veteran tabloid television reporter, were real, I have no doubt that I would tune into his program on a regular basis just to hear him tell one of <a href="https://www.cinemablend.com/movies/absolutely-ridiculous-rodney-dangerfield-one-liners">his priceless one-liners</a>.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="EUDvLuNENgQoxwTSvKZVtF" name="snlbronxbeat.jpg" alt="Amy Poehler and Maya Rudolph on SNL" src="https://cdn.mos.cms.futurecdn.net/EUDvLuNENgQoxwTSvKZVtF.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="betty-caruso-and-jodi-deltz-saturday-night-live">Betty Caruso And Jodi Deltz (Saturday Night Live)</h2><p>One of the <a href="https://www.cinemablend.com/television/the-best-snl-character-catchphrases">funniest catchphrases from <em>Saturday Night Live</em></a> comes from Maya Rudolph as Jodi Deitz, who often complains about her husband's frequent tendencies for moronic behavior, only to tearfully proclaim, "But I love him!" In fact, Jodi's husband is one of various recurring topics that she and fellow New York housewife Betty Caruso (Amy Poehler) like to boisterously sound off on as the co-hosts of a local talk show called <em>Bronx Beat</em>.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="PNpgdX8BuudJNdGqwPDSf5" name="Screen Shot 2022-01-14 at 10.17.09 AM.png" alt="James Franco in The Interview" src="https://cdn.mos.cms.futurecdn.net/PNpgdX8BuudJNdGqwPDSf5.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Sony Pictures)</span></figcaption></figure><h2 id="dave-skylark-the-interview">Dave Skylark (The Interview)</h2><p>James Franco gives one of the funniest performances of his career in directors Seth Rogen and Evan Goldberg's 2014 comedy, <em>The Interview</em>, as Dave Skylark, who discovers that he is the favorite TV personality of none other than Kim Jong-Un (Randall Park). Little does the leader of North Korea know, however, that, after he invites the talk show host and his producer (played by Rogen) to visit his home, the CIA has recruited them to help carry out his assassination.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ My Kids And I Watched Too Much Full House On Vacation, But It Did Make Me Look At One Specific Character Differently ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/my-kids-i-watched-too-much-full-house-but-made-me-look-one-character-differently</link>
                                                                            <description>
                            <![CDATA[ And it only took 30 years... ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">LxVvFhV7EzHmdM5c7PR29D</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/uUrDooXcNDG6gWiPJyEwY4-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Sun, 20 Jul 2025 16:04:00 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Philip Sledge ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/EkAcyCb4XhyxmBbguSQhEX.jpg ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Philip Sledge is a content writer at CinemaBlend with a focus on longform features. He started writing for the website in December 2019, though his journey in journalism started years earlier. Writing gigs with school newspapers, multiple daily newspapers, and other varied job experiences led him to this point where he actually gets to write about movies, shows, wrestling, and documentaries (which is a huge win in his eyes).&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Into&lt;/strong&gt;: As has been in the case for many years, Philip loves all things professional wrestling (especially early &#039;90s WCW and late-stage WCW if we&#039;re being honest). But outside of the squared circle, Philip is obsessed with all things George A. Romero as you can probably tell by the plethora of zombie stories he&#039;s written over the years. Documentaries, especially Frontline specials, are another passion for Philip, and he can often be heard going on and on about why everyone should watch some random doc about an obscure movie no one has ever seen before.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Excited About Right Now&lt;/strong&gt;: Oppenheimer... so much so that his wife has asked him multiple times to stop talking about it (but he keeps doing it). He&#039;s also into Peacock&#039;s Twisted Metal series, which has rekindled his love of the classic vehicular combat video game. And since we&#039;re being all nostaglic, he&#039;s pumped to see Teenage Mutant Ninja Turtles: Mutant Mayhem.&lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/uUrDooXcNDG6gWiPJyEwY4-1280-80.jpg">
                                                            <media:credit><![CDATA[ABC]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Screenshot of Candace Cameron Bure and Jodie Sweetin on Full House]]></media:description>                                                            <media:text><![CDATA[Screenshot of Candace Cameron Bure and Jodie Sweetin on Full House]]></media:text>
                                <media:title type="plain"><![CDATA[Screenshot of Candace Cameron Bure and Jodie Sweetin on Full House]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/uUrDooXcNDG6gWiPJyEwY4-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>I’ve talked about it before, but I grew up watching a ton of <em>Full House</em>, to the point where I’ve <a href="https://www.cinemablend.com/television/2553472/full-house-best-episodes-ranked"><u>seen all the best episodes</u></a> multiple times over the years. The longtime anchor of <a href="https://www.cinemablend.com/television/10-Greatest-TGIF-Comedies-All-Time-Ranked-120697.html"><u>ABC’s TGIF programming block</u></a> gave us so many unforgettable characters, but there’s one that annoyed me as a kid and later on as an adult while <a href="https://www.cinemablend.com/television/im-rewatching-full-house-for-the-first-time-as-a-parent-and-its-a-whole-other-experience"><u>revisiting </u><u><em>Full House</em></u><u> as a parent</u></a>. However, that recently changed when my kids and I watched a large chunk of the <a href="https://www.cinemablend.com/television/100-best-tv-sitcoms-of-all-time-ranked"><u>all-time great sitcom</u></a> (Seasons 3 through 5, to be exact), and I experienced a radical change.</p><p>No, it’s not Steve (he wasn’t introduced until Season 6), and it wasn’t Becky or Joey or even Kimmy Gibbler. Instead, it’s one of the Tanner girls, and I feel like I owe her a big apology. Let me explain.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="VDJbCM5t8ETPcEhrmUquA9" name="Full House 1.jpg" alt="Bab Saget and Candace Cameron Bure on Full House" src="https://cdn.mos.cms.futurecdn.net/VDJbCM5t8ETPcEhrmUquA9.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="watching-full-house-as-a-kid-i-couldn-t-stand-d-j-tanner">Watching Full House As A Kid, I Couldn't Stand D.J. Tanner</h2><p>Like a large portion of my generation, I watched <em>Full House</em> more than pretty much every other show in the ‘90s. My brothers and I would <a href="https://www.cinemablend.com/television/most-rewatchable-tv-shows-ever"><u>spend afternoons watching reruns</u></a> on TBS each summer, and that was after watching its original run earlier in the decade. More times than not, the episodes focusing on D.J. Tanner were the ones that would result in us refreshing our snacks or turning the TV off entirely to play PlayStation or watch a movie. </p><p>It's not like I actively despised her or anything like that, it's just that I remember thinking she came off as being bratty, petty, and a tad bit domineering towards her younger sisters.  It could have something to do with the fact that, being the middle child, I was drawn to Stephanie and even Michelle to a certain extent. And it also could be because I was a little boy watching <em>Full House</em> all those years ago, and I just didn't feel a connection with a teenage character going through stuff I wouldn't experience for a few more years. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="PhsthnG53re8UfUDRzd6hT" name="Full House Pillow.jpg" alt="D.J. holding her pillow person in Full House" src="https://cdn.mos.cms.futurecdn.net/PhsthnG53re8UfUDRzd6hT.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="but-then-i-watched-the-shape-up-episode-with-my-kids-and-learned-a-valuable-lesson">But Then I Watched The 'Shape Up' Episode With My Kids And Learned A Valuable Lesson</h2><p>So, what changed the way I saw D.J. Tanner? Well, one day my kids and I were watching the Season 4 episode titled “Shape Up,” which pretty much deals with D.J. trying to become comfortable with her body. As I watched on as my older daughter took in the episode and its messages about being comfortable with your changing body, it was like my perception of the character after 30-plus years changed in an instant. </p><p>Yeah, D.J. can be a lot at times, but that’s also true for <a href="https://www.cinemablend.com/television/Every-Major-Full-House-Character-Ranked-By-How-Memorable-Their-Hair-Was-71361.html"><u>all the characters on </u><u><em>Full House</em></u></a>. But while watching the episode, I realized that the D.J.-centric episodes were not necessarily for someone like me, but instead someone going through similar life changes. It was an eye-opening and perception-changing experience.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="3TtjQJV7yVpJynePh9FcoL" name="olsen twin cc" alt="One of the Olsen twins as Michelle and Candace Cameron Bure as DJ on a Season 7 episode of Full House." src="https://cdn.mos.cms.futurecdn.net/3TtjQJV7yVpJynePh9FcoL.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Max)</span></figcaption></figure><h2 id="after-that-i-realized-how-important-the-episode-and-d-j-s-struggles-could-be-for-young-girls">After That, I Realized How Important The Episode And D.J.'s Struggles Could Be For Young Girls</h2><p>After watching the episode and really thinking about it in the days that followed, I began to see how important of a character D.J. was in the grand scheme of things and how the episode’s messages about the importance of body positivity and self-esteem resonated with millions of kids around the world. I’m not saying that “Shape Up” is a replacement for earnest conversations between parents and children, but it can totally open the door for those kinds of talks.</p><p>On a similar note, experiencing this with my kids opened the door for my changed perception of D.J. Tanner after all these years, and I’m really glad it happened.</p><div class="product"><a data-dimension112="81a81e85-b82e-45fb-b3b5-bbbd1e0fca1f" data-action="Deal Block" data-label="HBO Max: Save Up To $41 On Annual Plans" data-dimension48="HBO Max: Save Up To $41 On Annual Plans" href="https://www.hbomax.com/" target="_blank" rel="nofollow"><figure class="van-image-figure "  ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:500px;"><p class="vanilla-image-block" style="padding-top:100.00%;"><img id="9P8ad6g6d9F3B8MJoXN8kK" name="HBO Max rebrand logo deal block sized" caption="" alt="" src="https://cdn.mos.cms.futurecdn.net/9P8ad6g6d9F3B8MJoXN8kK.jpg" mos="" align="middle" fullscreen="" width="500" height="500" attribution="" endorsement="" credit="" class=""></p></div></div></figure></a><p><a href="https://www.max.com/" target="_blank" rel="nofollow" data-dimension112="81a81e85-b82e-45fb-b3b5-bbbd1e0fca1f" data-action="Deal Block" data-label="HBO Max: Save Up To $41 On Annual Plans" data-dimension48="HBO Max: Save Up To $41 On Annual Plans" data-dimension25=""><strong>HBO Max: Save Up To $41 On Annual Plans</strong></a><strong><br></strong>With free trials and other introductory offers all but scrapped, the best way to save money on most subscriptions these days is by prepaying for a year upfront. The same goes for HBO Max, with up to 16% off its choice of three plans. Alternatively, its cheapest plan starts from <a href="https://www.max.com/" target="_blank" rel="nofollow">$9.99 a month</a>. I'd always recommend getting Max as a part of the bundle with Disney Plus and Hulu, though, <a href="https://www.disneyplus.com/welcome/disney-hulu-max-bundle" target="_blank" rel="nofollow">starting from $16.99 a month</a>.<a class="view-deal button" href="https://www.hbomax.com/" target="_blank" rel="nofollow" data-dimension112="81a81e85-b82e-45fb-b3b5-bbbd1e0fca1f" data-action="Deal Block" data-label="HBO Max: Save Up To $41 On Annual Plans" data-dimension48="HBO Max: Save Up To $41 On Annual Plans" data-dimension25="">View Deal</a></p></div><p>“Shape Up,” along with the rest of <em>Full House,</em> is currently streaming with an <a href="https://www.cinemablend.com/television/2570432/subscribing-to-hbo-max-what-to-know-about-the-price-options-and-what-the-streaming-service-offers"><u>HBO Max subscription</u></a> if you want to go back and revisit this classic sitcom and all its life lessons. </p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ Full House's Jodie Sweetin Talks Coming To Terms With Being Known As 'Stephanie Tanner Forever,' And I'm Loving Her Positivity ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/full-house-jodie-sweetin-coming-terms-being-known-stephanie-tanner-forever</link>
                                                                            <description>
                            <![CDATA[ 'Everywhere you look ...' ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">dghgf9vfZkCWhsZLKr7UzV</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/Yy4gCBkZB9Bv827LWsQ54A-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Sat, 19 Jul 2025 06:10:00 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Heidi Venable ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/w7HQ9MvRSDd7diNpTmruW9.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Heidi Venable is a Content Producer for CinemaBlend. She started freelancing for the site in 2020 and officially came on board in 2021. Her job entails writing news stories and TV reactions from some of her favorite prime-time shows like Grey&#039;s Anatomy and The Bachelor. She graduated from Louisiana Tech University with a degree in Journalism and worked in the newspaper industry for almost two decades in multiple roles including Sports Editor, Page Designer and Online Editor.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Into&lt;/strong&gt;: Heidi grew up in the 1990s, and her tastes strongly reflect that. She can (and does) quote Friends constantly, enjoys a good West Wing binge, thinks Can&#039;t Hardly Wait was the most influential movie of her life and finds solace in 311 concerts. On Sundays during football season, she can be found cheering on the New Orleans Saints with her husband and two daughters. Who Dat! She loves to read but usually settles for a pop culture podcast, and thinks the best weekends are spent cooking and playing cards with friends and family, preferably with some UFC fights or other sporting event on TV.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Excited About Right Now&lt;/strong&gt;: Football season, Pumpkin Spice Lattes and everything related to fall and cooler weather. The Game of Roses podcast and all things The Bachelor, and new episodes of Grey&#039;s Anatomy, Love Is Blind, The Voice, OMITB and more.&amp;nbsp;&lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/Yy4gCBkZB9Bv827LWsQ54A-1280-80.jpg">
                                                            <media:credit><![CDATA[Netflix]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Stephanie Tanner smiling in Fuller House kitchen]]></media:description>                                                            <media:text><![CDATA[Stephanie Tanner smiling in Fuller House kitchen]]></media:text>
                                <media:title type="plain"><![CDATA[Stephanie Tanner smiling in Fuller House kitchen]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/Yy4gCBkZB9Bv827LWsQ54A-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>Some <a href="https://www.cinemablend.com/television/actors-who-will-always-be-known-for-one-iconic-television-character">television characters are so iconic</a> that the actors who play them will <a href="https://www.cinemablend.com/movies/great-actors-who-will-forever-be-remembered-for-one-role">forever be known for that role</a>. That’s definitely the case for Jodie Sweetin (and probably the rest of the <em>Full House</em> cast, too). While Sweetin was merely 5 years old when she first portrayed Stephanie Tanner on the ABC sitcom, it’s a role that has followed her for nearly 40 years, and I love her positive take on how she came to terms with that.</p><p>Jodie Sweetin has appeared on the <a href="https://www.cinemablend.com/television/2568036/upcoming-hallmark-movies-full-list-of-new-titles-and-premiere-dates">Hallmark schedule</a> several times in recent years with projects like <em>The Jane Mysteries</em>, and she starred in the Lifetime movie <em>Dateless to Dangerous: My Son's Secret Life</em>, which premiered on the <a href="https://www.cinemablend.com/television/2025-tv-premiere-date-schedule-upcoming-new-returning-shows">2025 TV schedule</a> in June. No matter how many TV movies she does, though, Sweetin knows the truth. She told <a href="https://people.com/jodie-sweetin-okay-with-being-associated-with-full-house-exclusive-11766856">People</a>:</p><div><blockquote><p>I will be Stephanie Tanner forever. And I've come to be really okay with that over the last 20 years.</p></blockquote></div><p>Stephanie was the middle sister on <em>Full House</em>, falling between Candace Cameron Bure’s DJ and the Olsen twins’ Michelle. Part of what endeared audiences to the saccharine-sweet sitcom was being able to watch the young actresses <a href="https://www.cinemablend.com/television/candace-cameron-bure-rare-comment-about-mary-kate-ashley-olsen-how-they-contributed-full-houses-success">grow up literally in front of our eyes</a> over the course of eight seasons (which can be streamed with either a <a href="https://www.cinemablend.com/television/2570844/subscribing-to-hulu-the-price-whats-included-and-everything-else-to-know">Hulu subscription</a>, <a href="https://www.cinemablend.com/news/2492773/how-to-best-use-disney-tips-to-get-the-most-out-of-the-streaming-service">Disney+ subscription</a> or <a href="https://www.cinemablend.com/television/2570432/subscribing-to-hbo-max-what-to-know-about-the-price-options-and-what-the-streaming-service-offers">HBO Max subscription</a>).</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Q8ods3L76HTaDmZxz4n7mU" name="Full House Jodie Sweetin Dance" alt="Stephanie getting ready to dance on Full House." src="https://cdn.mos.cms.futurecdn.net/Q8ods3L76HTaDmZxz4n7mU.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Max)</span></figcaption></figure><p>However, that also made them kind of synonymous with those roles, for better or worse. For Jodie Sweetin, she’s decided it was for the better, and she explained how reprising the role actually led her to branch out in her career:</p><div><blockquote><p>I kind of walked away from the business at some point in my late 20s and was working in other fields, and I was totally fine. I was happy. I would've continued on that, but getting the chance to come back and do Fuller and bring Stephanie back to life was amazing and wonderful. It also gave me the opportunity to do other things because I think finally people were like, ‘Oh, you're an adult now.’</p></blockquote></div><p><em>Fuller House</em> featured much of the same cast (but notably <a href="https://www.cinemablend.com/streaming-news/full-houses-jodie-sweetin-shared-the-best-reasoning-for-why-the-olsen-twins-didnt-return-for-netflixs-fuller-house">not Mary-Kate and Ashley Olsen, for good reason</a>) and centered around a recently widowed DJ and her three sons. According to Jodie Sweetin, giving people the chance to see her as an adult — even if she was still technically Stephanie Tanner — kick-started a new chapter in her acting career. </p><div class="product"><a data-dimension112="76bd47d9-3175-4bae-bc8a-8a2a74fa3b1f" data-action="Deal Block" data-label="Disney Plus + Hulu + Max:" data-dimension48="Disney Plus + Hulu + Max:" href="https://www.disneyplus.com/welcome/disney-hulu-max-bundle" target="_blank" rel="nofollow"><figure class="van-image-figure "  ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:600px;"><p class="vanilla-image-block" style="padding-top:100.00%;"><img id="ZYwStpduTFJc3Wfqt2iamV" name="disney plus max bundle" caption="" alt="" src="https://cdn.mos.cms.futurecdn.net/ZYwStpduTFJc3Wfqt2iamV.png" mos="" align="middle" fullscreen="" width="600" height="600" attribution="" endorsement="" credit="" class=""></p></div></div></figure></a><p><a href="https://www.disneyplus.com/welcome/disney-hulu-max-bundle" target="_blank" rel="nofollow" data-dimension112="76bd47d9-3175-4bae-bc8a-8a2a74fa3b1f" data-action="Deal Block" data-label="Disney Plus + Hulu + Max:" data-dimension48="Disney Plus + Hulu + Max:" data-dimension25=""><strong>Disney Plus + Hulu + Max: </strong><del><strong>$29.97</strong></del><strong> $16.99 A Month</strong></a><strong><br></strong>Arguably the ultimate streaming bundle, I think this is one of the most exciting streaming deals available right now. Yes, it is available all year round, but it marries together some of the most exciting on-demand libraries for streaming. Get all your <em>Marvel</em> with a helping of Hulu Originals like <em>Only Murders in the Building</em> and Max's eclectic selection of golden oldies like <em>Full House</em> and exciting newer hits like <em>The Last of Us.</em><a class="view-deal button" href="https://www.disneyplus.com/welcome/disney-hulu-max-bundle" target="_blank" rel="nofollow" data-dimension112="76bd47d9-3175-4bae-bc8a-8a2a74fa3b1f" data-action="Deal Block" data-label="Disney Plus + Hulu + Max:" data-dimension48="Disney Plus + Hulu + Max:" data-dimension25="">View Deal</a></p></div><p>In addition to some TV movies and reality competition shows, Jodie Sweetin has also started a rewatch podcast with <em>Full House</em> and <em>Fuller House</em> co-star Andrea Barber, which has even further <a href="https://www.cinemablend.com/television/fuller-house-gave-jodie-sweetin-a-whole-new-appreciation-for-growing-up-on-full-house-thoughtful-take">deepened her appreciation for the fans</a> who continue to show interest in the Tanner family after so many years.</p><p>Jodie Sweetin likely can’t do anything to change the fact that she’ll always be known as Stephanie Tanner, but she can control how she feels about her childhood character following her into adulthood. I love how she’s chosen to embrace it. </p><p>In addition to <em>Full House</em> being available to stream on multiple services, <em>Fuller House</em> can be accessed with a <a href="https://www.cinemablend.com/streaming-news/netflix-subscription-the-plans-the-price-and-whats-included">Netflix subscription</a>.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ The Story Behind Why Tia And Tamera Mowry Used To Watch Mary-Kate And Ashley Olsen: 'Twin Girls Watching Over Twin Girls' ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/story-behind-why-tia-tamera-mowry-used-watch-mary-kate-ashley-olsen-full-house</link>
                                                                            <description>
                            <![CDATA[ Nothing like twin sitting the Olsens! ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">anJzPECfWbUEZLyWofwmag</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/7rCaaPRcjhuwUnLxNSwwWB-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Tue, 01 Jul 2025 03:01:12 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Carly Levy ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/W2S7fhS2x3ZyKqykexke3P.jpg ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Carly Levy has been a freelance writer for CinemaBlend starting in 2022 covering mostly movies with a sprinkle of television. After graduating at Florida Atlantic University with a degree in film and theater in 2015, she worked for a year as a journalist for Talk Media covering South Florida news. In 2017, she spent four years as a ghostwriter writing about addiction and mental health for rehab and therapy blogs. Now, she divides her time writing about the subjects of both entertainment and mental health issues.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What They&#039;re Into&lt;/strong&gt;: Carly is an avid cinephile who is always looking for the next best film to watch whether it goes back to the silent film era to what&#039;s playing in theaters. Her analytical mindset enhances her writing as she gains true understanding of the characters and stories that makes a movie great enough to write about. Her passion ranges from following film scavenger hunts on Letterboxd to discover new films and creating watchlists based on the latest trailers. She enjoys the originality and freshness indie cinema brings, particularly A24 films. During her spare time, Carly loves to listen to post hardcore rock music, watch classic television sitcoms, and reads a variety of books. She also likes to challenge her writing by writing essays on various trending topics that draw her eye.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What They&#039;re Excited About Right Now&lt;/strong&gt;: The latest movies hitting the &quot;Big Five&quot; film festivals (especially Venice and Sundance). Anything A24 and Wes Anderson touches. Continuously making my mark through my writing and creating watchlists.&amp;nbsp;&lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/7rCaaPRcjhuwUnLxNSwwWB-1280-80.jpg">
                                                            <media:credit><![CDATA[The WB]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Mary-Kate and Ashley Olsen cameoed on a Sister, Sister episode with Tia and Tamera Mowry.]]></media:description>                                                            <media:text><![CDATA[Mary-Kate and Ashley Olsen cameoed on a Sister, Sister episode with Tia and Tamera Mowry.]]></media:text>
                                <media:title type="plain"><![CDATA[Mary-Kate and Ashley Olsen cameoed on a Sister, Sister episode with Tia and Tamera Mowry.]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/7rCaaPRcjhuwUnLxNSwwWB-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>When you think about it, twin actors played a big role in ‘90s <a href="https://www.cinemablend.com/television/rating-sitcom-families-by-how-well-they-got-along"><u>family sitcoms</u></a>. Whether they played a singular role like Mary-Kate and Ashley Olsen did in <em>Full House</em>, or how Tia and Tamera Mowry <a href="https://www.cinemablend.com/movies/times-celebrity-siblings-acted-alongside-each-other">acted alongside each other</a> in <em>Sister, Sister, </em>it was twin city. Here’s a funny coincidence between the set of twin actors— the <a href="https://www.cinemablend.com/television/that-time-tia-and-tamera-mowry-babysat-mary-kate-and-ashley-olsen-on-the-set-of-full-house"><u>Mowry twins babysat the Olsen twins on the set of </u><u><em>Full House</em></u></a> , and gave a very interesting reason why.</p><p>It was during their <em>Full House</em> days that little Mary-Kate and Ashley Olsen met <em>Sister, Sister</em>’s Tia and Tamera Mowry. According to Tia’s <a href="https://www.instagram.com/p/DLQ5-G3vmx6/?img_index=13"><u>Instagram</u></a> post, you can thank their younger brother, Tahj, for bringing everyone together on set:</p><div><blockquote><p>My brother was cast as Teddy, and since my mom didn’t have a sitter, she brought me and Tamera with her. We would sit in the audience while they filmed.</p></blockquote></div><p>That must have been such a treat for Tia and Tamera Mowry to see their little bro act with TV’s Michelle. In fact, I remember when the <em>Twitches</em> actress played the singular role of Teddy’s sister, Denise, in the <em>Full House</em> episode “The Devil Made Me Do It” (which is available to stream on your <a href="https://www.cinemablend.com/television/2570432/subscribing-to-hbo-max-what-to-know-about-the-price-options-and-what-the-streaming-service-offers"><u>HBO Max subscription</u></a>). Looking back, it’s an amazing crossover moment that quietly connected two sets of twin stars before they made a mark on television.</p><p>Tia and Tamera Mowry may have thought they were just going to play the role of audience members when they visited the set of <em>Full House.</em> Little did they know they’d also be playing the role of Mary-Kate and Ashley's babysitters:</p><div><blockquote><p>They had us babysit Mary Kate and Ashley on set. The crew would have us play with Mary Kate and Ashley between takes. Everyone thought it was the cutest thing. Twin girls watching over twin girls.</p></blockquote></div><p>I would love to see a behind-the-scenes video of Tia and Tamera Mowry playing with the Olsens, especially if it was “the cutest thing!” Tamera Howsley-Mowry described the on-set babysitting moments in her memoir <em>You Should Sit Down For This,</em> saying that all the <em>It Takes Two</em> actresses wanted was matzo ball soup. That’s my kind of babysitting client!</p><p>One of the <a href="https://www.cinemablend.com/television/sister-sister-things-i-still-love-about-the-classic-90s-sitcom"><u>best things that I loved about </u><u><em>Sister, Sister</em></u></a> was Mary-Kate and Ashley’s season 4 cameo in the episode “Slime Party” (which is available to stream on your <a href="https://www.cinemablend.com/television/2570844/subscribing-to-hulu-the-price-whats-included-and-everything-else-to-know"><u>Hulu subscription</u></a>). Tia and Tamera decided to compete on a quiz show against the Olsens, where one set of twins would have to guess the right trivia answers to prevent their sister from getting slimed. </p><p>Now that I know the Mowry twins babysat the Olsens, I can imagine what a sweet reunion it must have been for everyone. Sitcom moments like these were really special in blending ‘90s star power—even more so when you have twin energy with which to fill the screen.</p><p>So if Tia and Tamera Mowry had to stay on-set while Tahj was working on <em>Full House,</em> they might as well have had some babysitting fun with the Olsen Twins, right? After all, what better way to pass the time than to hang out with some of the coolest toddler stars of the ‘90s?</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ 32 Crazy Dream Sequences From Movies And TV Shows ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/movies/crazy-dream-sequences-from-movies-and-tv-shows</link>
                                                                            <description>
                            <![CDATA[ I must be dreaming. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">yvoZS9pxtLJnQCknKHxj3F</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/eqSK622nJvXijEpXUUZDv8-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Fri, 27 Jun 2025 18:30:00 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Movies]]></category>
                                                                                                                    <dc:creator><![CDATA[ Jason Wiese ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/62SRu9Bi2SyJGrpzKXAfsK.jpg ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Jason Wiese writes feature stories for CinemaBlend. His occupation results from years dreaming of a filmmaking career, settling on a &quot;professional film fan&quot; career, studying journalism at Lindenwood University in St. Charles, MO (where he served as Culture Editor for its student-run print and online publications), and a brief stint of reviewing movies for fun. He would later continue that side-hustle of film criticism on TikTok (@wiesewisdom), where he posts videos on a semi-weekly basis.&lt;/p&gt;&lt;p&gt;&lt;br&gt;&lt;/p&gt;&lt;p&gt;Jason has been writing since he was able to pick up a washable marker, with which he wrote his debut illustrated children&#039;s story, later transitioning to a short-lived comic book series and (very) amateur filmmaking before finally settling on pursuing a career in writing about movies in lieu of making them. Look for his name in almost any article about Batman.&lt;/p&gt;&lt;p&gt;&lt;br&gt;&lt;/p&gt;&lt;p&gt;&lt;strong&gt;What He&#039;s Into&lt;/strong&gt;: Readers may notice a recurring theme of horror and superhero-related content (especially in regards to Batman) in much of Jason&#039;s work, but his favorite film of all time is more in line with traditional action/adventure stories: &lt;em&gt;Raiders of the Lost Ark&lt;/em&gt;. His favorite TV series is the gritty, grounded crime thriller &lt;em&gt;Breaking Bad&lt;/em&gt; and if you catching him reading anything, it is probably a comic book (and, more often than not, one featuring Batman). More important to him than entertainment, however, are his wife and two dogs.&lt;/p&gt;&lt;p&gt;&lt;br&gt;&lt;/p&gt;&lt;p&gt;&lt;strong&gt;What He&#039;s Excited About Right Now&lt;/strong&gt;: Jason typically tries to keep his excitement and expectations for any upcoming movies as low as possible, but he is certainly looking forward to returning to Matt Reeves&#039; vision of Gotham City in the upcoming follow-up to &lt;em&gt;The Batman&lt;/em&gt; and just about any horror movie set to haunt cinemas soon.&lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/eqSK622nJvXijEpXUUZDv8-1280-80.jpg">
                                                            <media:credit><![CDATA[Gramercy Pictures]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Jeff Bridges wearing a huge smile in The Big Lebowski.]]></media:description>                                                            <media:text><![CDATA[Jeff Bridges wearing a huge smile in The Big Lebowski.]]></media:text>
                                <media:title type="plain"><![CDATA[Jeff Bridges wearing a huge smile in The Big Lebowski.]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/eqSK622nJvXijEpXUUZDv8-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>Some might argue that a scene from a film or TV series that turns out to have existed all in a character’s head is a cop out. Maybe that’s true in some respects, but when done right and without misleading intentions, dream sequences can be used as a great opportunity to let artists run wild with their imaginations, resulting in some of a title’s most memorable moments. Here are some of the most wonderfully surreal scenes from the big and small screen that may have had you questioning if you had entered dreamland.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="bEtgZ6tBdJ72DPRJ8mpVC6" name="dreamtrainspotting" alt="Scene from a crazy dream sequence in Trainspotting" src="https://cdn.mos.cms.futurecdn.net/bEtgZ6tBdJ72DPRJ8mpVC6.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: PolyGram Filmed Entertainment)</span></figcaption></figure><h2 id="dawn-haunts-renton-trainspotting">Dawn Haunts Renton (Trainspotting)</h2><p>Director Danny Boyle's 1996 adaptation of Irvine Welsh's novel <em>Trainspotting</em> follows a group of Scottish addicts trying to get clean, none of whom has a harder time with it than Mark Renton (Ewan McGregor). One signature scene sees him locked in his childhood bedroom by his parents and forced to wean off his habit cold turkey, during which he suffers an intense fever dream featuring hallucinations of his parents on a game show, his various friends, and the spirit of a deceased infant he once knew climbing on his ceiling.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="LLACMXwnYZC8HNQ2JFE8kD" name="perchance to dream.jpg" alt="Batman in "Perchance to Dream'" src="https://cdn.mos.cms.futurecdn.net/LLACMXwnYZC8HNQ2JFE8kD.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros. Television)</span></figcaption></figure><h2 id="bruce-wayne-s-alternate-life-batman-the-animated-series">Bruce Wayne's Alternate Life (Batman: The Animated Series)</h2><p>One of the <a href="https://www.cinemablend.com/television/2571934/the-best-batman-the-animated-series-episodes-ranked">best episodes of <em>Batman: The Animated Series</em></a>, let alone one of the strangest, is "Perchance to Dream." As part of a scheme by Mad Hatter, Bruce Wayne finds himself living in a fantasy in which his parents were never murdered, he is engaged to Selina Kyle, and someone other than him is protecting the streets of Gotham as Batman.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="qetowm2GBV2QEjUqDnKhC6" name="dreamt2" alt="Scene from a crazy dream sequence in Terminator 2: Judgment Day" src="https://cdn.mos.cms.futurecdn.net/qetowm2GBV2QEjUqDnKhC6.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Tri-Star Pictures)</span></figcaption></figure><h2 id="sarah-s-apocalyptic-nightmare-terminator-2-judgment-day">Sarah's Apocalyptic Nightmare (Terminator 2: Judgment Day)</h2><p>One thing that makes the <a href="https://www.cinemablend.com/news/1639139/30-best-sci-fi-movies-of-all-time">classic sci-fi movie</a> <em>Terminator 2: Judgment Day</em> one of the all-time greatest sequels is the way it depicts Sarah Connor (Linda Hamilton) and her growth as a character following the traumatic events of the first film, especially through one wild fantasy sequence. In the dream, she witnesses her happier past self and other bystanders at a park where they suffer a nuclear blast that ends up burning off her skin, leaving her remaining skeleton clinging to a chain-link fence.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="qtcuKSg2CYiVgjhpfoKCpK" name="bobbyewingshowerrevealdallas" alt="Bobby Ewing alive shower reveal on Dallas" src="https://cdn.mos.cms.futurecdn.net/qtcuKSg2CYiVgjhpfoKCpK.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="all-of-season-9-dallas">All Of Season 9 (Dallas)</h2><p><em>Dallas</em> delivered one of the <a href="https://www.cinemablend.com/television/tv-show-retcons-left-us-confused">craziest retcons in TV history</a> when it was revealed that the death of Bobby Ewing (Patrick Duffy) and the entire ninth season of the hit primetime soap opera all happened in the head of his wife, Pamela (Victoria Principal). The retcon was prompted after Duffy, who had previously left the show, agreed to return for Season 10, which opens with Pamela waking up to find Bobby in the shower.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="vNH9Tzuq9CyHQ2PfsQoe96" name="dreamgilmore" alt="Scene from a crazy dream sequence in Happy Gilmore" src="https://cdn.mos.cms.futurecdn.net/vNH9Tzuq9CyHQ2PfsQoe96.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Universal Pictures)</span></figcaption></figure><h2 id="happy-s-happy-place-happy-gilmore">Happy's Happy Place (Happy Gilmore)</h2><p>The <a href="https://www.cinemablend.com/movies/best-golf-movies">classic golf movie</a>, 1996's <em>Happy Gilmore</em>, stars Adam Sandler in the title role of a guy with a talent for tee time, but the rage of a hockey player, which his trainer, Chubbs (Carl Weathers), tries to help him control by envisioning his own "happy place." He imagines his girlfriend, Virginia (Julie Bowen), carrying drink pitchers, his grandmother (Frances Bay) finding the money she needs from a slot machine, and a little cowboy riding an old-fashioned bicycle, for some reason. However, a later attempt to escape into this fantasy world is interrupted by the invasion of his nemesis, Shooter McGavin (Christopher McDonald).</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="qWroQuCMfAhv5EJ4oa2T86" name="dream3rdrock" alt="Scene from a crazy dream sequence in 3rd Rock from the Sun" src="https://cdn.mos.cms.futurecdn.net/qWroQuCMfAhv5EJ4oa2T86.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: The Carsey-Werner Company)</span></figcaption></figure><h2 id="the-solomons-suffer-from-bizarre-dreams-3rd-rock-from-the-sun">The Solomons Suffer From Bizarre Dreams (3rd Rock From The Sun)</h2><p>The two-part Season 2 finale of <em>3rd Rock from the Sun</em> tried something unique by airing in 3D, but saving that format for some incredibly insane sequences. The surreal, avant garde scenes are dreams that Dick (John Lithgow) and the rest of his extra-terrestrial comrades are experiencing, but for the first time since taking human form, which leads them to assume they are ill.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="WGy22Q3Rfegm3K5FR9xL96" name="dreamchristmasstory" alt="Scene from a crazy dream sequence in A Christmas Story" src="https://cdn.mos.cms.futurecdn.net/WGy22Q3Rfegm3K5FR9xL96.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: MGM)</span></figcaption></figure><h2 id="old-blue-saves-the-day-a-christmas-story">Old Blue Saves The Day (A Christmas Story)</h2><p>The <a href="https://www.cinemablend.com/movies/best-christmas-movies-all-time">classic holiday movie</a>, 1983's <em>A Christmas Story</em>, follows young Ralphie (Peter Billingsley) and his devotion to making sure he finds an official Red Ryder, carbine action, two-hundred shot range model air rifle under the tree. He seems to believe that it will make his life better, based on a daydream in which he, dressed as a hero named Old Blue, uses the BB shooter to rescue his family from criminals.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="oRwtPJX6ySpXaDNaEXnZ86" name="dream812" alt="Scene from a crazy dream sequence in 8 1/2" src="https://cdn.mos.cms.futurecdn.net/oRwtPJX6ySpXaDNaEXnZ86.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Cineriz)</span></figcaption></figure><h2 id="the-opening-scene-8-1-2">The Opening Scene (8 1/2)</h2><p>Federico Fellini's signature 1963 film opens with a bizarre dream in which the main character gets trapped in his smoke-filled car in full-stop, literal bumper-to-bumper traffic. After he finally escapes, it cuts to him flying through the clouds until he is pulled down by his ankle by a person on a beach, and descends into the water just as he awakens.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="LXWCFbfQWJwNVAMVXv7S3h" name="biglebowskigutterballs" alt="Jeff Bridges as The Dude and Julianne Moore as Maude Lebowski starring in the Gutterballs scene from The Big Lebowski" src="https://cdn.mos.cms.futurecdn.net/LXWCFbfQWJwNVAMVXv7S3h.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Gramercy Pictures)</span></figcaption></figure><h2 id="gutterballs-the-big-lebowski">Gutterballs (The Big Lebowski)</h2><p>There are two great dream sequences from Joel and Ethan Coen's hilarious, <a href="https://www.cinemablend.com/movies/the-100-best-movies-of-the-1990s">classic '90s movie</a>, 1998's <em>The Big Lebowski</em>, the first of which sees The Dude (Jeff Bridges) flying over L.A. trying to reach his stolen rug after receiving a crack on the jaw. However, the more memorable scene sees him, after being sedated by Jackie Treehorn, imagining he is the star of a Busby Berkeley-inspired adult film about bowling.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="z2zsb8kRWywEgvprbmzc96" name="dreamnewhart" alt="Scene from the very end of Newhart" src="https://cdn.mos.cms.futurecdn.net/z2zsb8kRWywEgvprbmzc96.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: 20th Television)</span></figcaption></figure><h2 id="the-entire-series-newhart">The Entire Series (Newhart)</h2><p>One of the most iconic, oft-parodied, and simply <a href="https://www.cinemablend.com/television/tv-shows-that-actually-ended-well">best TV series finales</a> is that of <em>Newhart</em>, in which the actor and comedian wakes up in bed as Bob Hartley, his role from his first hit sitcom, <em>The Bob Newhart Show</em>. His co-star from said 1970s hit, Suzanne Pleshette, wakes up next to him as Hartley's wife, Emily, and he explains to her that his entire life as Vermont innkeeper Dick Loudon was a dream.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="VUzHE8G2casXpkNau7VLSH" name="RosemarysBaby.png" alt="Mia Farrow in Rosemary's Baby" src="https://cdn.mos.cms.futurecdn.net/VUzHE8G2casXpkNau7VLSH.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Paramount Pictures)</span></figcaption></figure><h2 id="rosemary-drifts-on-a-mattress-rosemary-s-baby">Rosemary Drifts On A Mattress (Rosemary's Baby)</h2><p>Some of the <a href="https://www.cinemablend.com/new/30-Best-Horror-Movies-All-Time-122567.html">best horror movies</a> include a dream sequence that sneaks up on you with its more nightmarish qualities, such as in 1968's <em>Rosemary's Baby</em>. The first half of Rosemary's (Mia Farrow) dream is somewhat peaceful, showing her lying on a mattress floating on a bed of water, but in the second half of the dream, she is attacked by a demon. To make matters worse, that occurrence might not be part of the dream at all.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="M2HATNbveVVwhBzDEE9r86" name="dreambuffy" alt="Scene from a crazy dream sequence in Buffy the Vampire Slayer" src="https://cdn.mos.cms.futurecdn.net/M2HATNbveVVwhBzDEE9r86.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: 20th Century Fox Television)</span></figcaption></figure><h2 id="buffy-s-slaying-is-a-delusion-buffy-the-vampire-slayer">Buffy's Slaying Is A Delusion? (Buffy The Vampire Slayer)</h2><p>Sarah Michelle Gellar's title hero from <em>Buffy the Vampire Slayer</em> has likely wished that her life could be free of encounters with bloodsuckers, demons, and all kinds of things that go bump in the night, but she probably never wanted to experience it the way she does in Season 6's "Normal Again." Buffy becomes exposed to a demonic, hallucinogenic venom that causes her to become trapped in a fantasy in which she is a mental patient, and her life of fighting paranormal activity has been all in her head.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="b8ajSovZVXftthGYJP4286" name="dreamwerewolf" alt="Scene from a crazy dream sequence in An American Werewolf in London" src="https://cdn.mos.cms.futurecdn.net/b8ajSovZVXftthGYJP4286.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Universal Pictures)</span></figcaption></figure><h2 id="nazi-werewolves-an-american-werewolf-in-london">Nazi Werewolves (An American Werewolf In London)</h2><p>Writer and director John Landis' <em>An American Werewolf in London</em> boasts one of the most incredible moments of body horror in cinematic history, but one could argue a crazier moment in the <a href="https://www.cinemablend.com/streaming-news/10-movies-and-shows-about-werewolves-to-watch-streaming">classic werewolf movie</a> happens earlier. While recovering from his animal attack, David (David Naughton) dreams he is back in the States with his family when a group of gun-toting, lycanthropic SS soldiers invade.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="GS4v2CWT9iPturkHaXeV96" name="dreamsopranos" alt="Scene from a crazy dream sequence in The Sopranos" src="https://cdn.mos.cms.futurecdn.net/GS4v2CWT9iPturkHaXeV96.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO)</span></figcaption></figure><h2 id="tony-becomes-a-salesman-the-sopranos">Tony Becomes A Salesman (The Sopranos)</h2><p>Tony Soprano (James Gandolfini) experienced multiple, eye-opening dream sequences throughout HBO's run of <em>The Sopranos</em>, including one that took place during most of an entire episode. In Season 6's "Join the Club," a comatose Tony dreams of an alternate life away from the DiMeo Family in which he is an ordinary salesman named Kevin Finnerty.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="m5s9EfzapU9GVHmPHt5WB6" name="dreampeewee" alt="Scene from a crazy dream sequence in Pee-wee's Big Adventure" src="https://cdn.mos.cms.futurecdn.net/m5s9EfzapU9GVHmPHt5WB6.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros.)</span></figcaption></figure><h2 id="the-clown-hospital-pee-wee-s-big-adventure">The Clown Hospital (Pee-wee's Big Adventure)</h2><p>A <a href="https://www.cinemablend.com/news/2571944/surprisingly-scary-scenes-from-80s-kids-movies-including-the-dark-crysta">movie scene that scared many '80s kids</a> occurs in <em>Pee-wee's Big Adventure</em> when the titular man-child (played by Paul Reubens) has a nightmare about his missing bike. The prized, two-wheel vehicle is picked up in scraps by a group of horrifying harlequins who use unconventional and concerning methods to put it back together again.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Zh6yi6zaEmVb9sgYaX8c8o" name="Shadow Play.jpg" alt="Shadow Play episode of The Twilight Zone" src="https://cdn.mos.cms.futurecdn.net/Zh6yi6zaEmVb9sgYaX8c8o.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Paramount)</span></figcaption></figure><h2 id="adam-s-repeated-death-row-sentence-the-twilight-zone">Adam's Repeated Death Row Sentence (The Twilight Zone)</h2><p>All of the <a href="https://www.cinemablend.com/television/2548435/the-best-twilight-zone-episodes-ranked">best episodes of <em>The Twilight Zone</em></a> feel like a dream (or a nightmare), but Season 2's "Shadow Play" actually takes place entirely in one. Dennis Weaver stars as a convicted criminal trying to convince the other characters that his condemnation is merely part of a recurring nightmare.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="mhcoZopTToWMsCevZxcfB6" name="dreamcarrie" alt="Scene from a crazy dream sequence in Carrie" src="https://cdn.mos.cms.futurecdn.net/mhcoZopTToWMsCevZxcfB6.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: United Artists)</span></figcaption></figure><h2 id="sue-visits-carrie-s-grave-carrie">Sue Visits Carrie's Grave (Carrie)</h2><p>Director Brian de Palma's <a href="https://www.cinemablend.com/news/2566855/adapting-stephen-king-carrie-queen-of-prom-brian-de-palma-sissy-spacek">1976 adaptation of Stephen King's <em>Carrie</em></a> ends with one of the most iconic and influential jump scares, which actually inspired the ending of 1980's <em>Friday the 13th</em>. A grieving Sue Snell (Amy Irving) dreams that she is visiting the resting place of her titular telekinetic classmate (Sissy Spacek) where her bloodied arm emerges from the ground and grasps onto her. Sue does not wake up from the nightmare, but is unable to stop screaming in her sleep.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="6vbaBeYtJTVoJpAEzzQr96" name="dreamtwinpeaks" alt="Scene from a crazy dream sequence in Twin Peaks" src="https://cdn.mos.cms.futurecdn.net/6vbaBeYtJTVoJpAEzzQr96.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Lynch/Frost Productions)</span></figcaption></figure><h2 id="cooper-s-first-visit-to-the-red-room-twin-peaks">Cooper's First Visit To The Red Room (Twin Peaks)</h2><p>Most of <a href="https://www.cinemablend.com/news/2548094/the-5-best-david-lynch-movies-ranked">David Lynch's movies</a> and TV projects feel like long dream sequences, but when depicting Special Agent Dale Cooper's (Kyle MacLachlan) nightmare about the Red Room in an early episode of <em>Twin Peaks</em>, the master of surrealism really goes for it, resulting in a dream sequence more authentic than most. The inexplicably aged-up Coop meets a dancing little person who tells him, in backwards speak, "That gum you like is going to come back in style." He then meets a blonde woman resembling Laura Palmer (played by Sheryl Lee) and asks if she is the murdered teen, to which she responds, also in backwards speak, "I feel like I know her, but sometimes my arms bend back."</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="BwogoDi2DkU9xzy7dh9YC6" name="dreamdumb" alt="Scene from a crazy dream sequence in Dumb and Dumber" src="https://cdn.mos.cms.futurecdn.net/BwogoDi2DkU9xzy7dh9YC6.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: New Line Cinema)</span></figcaption></figure><h2 id="lloyd-and-mary-s-romance-dumb-and-dumber">Lloyd And Mary's Romance (Dumb And Dumber)</h2><p>In the 1994 <a href="https://www.cinemablend.com/movies/best-jim-carrey-movies-ranked">Jim Carrey movie favorite</a>, <em>Dumb and Dumber</em>, while traveling to Aspen, Lloyd Christmas (Carrey) fantasizes that his crush, Mary Swanson (Lauren Holly), will fall for him immediately after he returns her missing briefcase. The daydream continues to show highlights of their imaginary relationship, from a party where Lloyd entertains guests with uproarious tricks (like lighting his flatus on fire), to a romantic dinner where he engages in a cinematic-style kung fu fight.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="ABn6jqHwLfD5ePNqxM6KD6" name="dreammrrobot" alt="Scene from a crazy dream sequence in Mr. Robot" src="https://cdn.mos.cms.futurecdn.net/ABn6jqHwLfD5ePNqxM6KD6.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: USA)</span></figcaption></figure><h2 id="elliott-90s-sitcom-fantasy-mr-robot">Elliott '90s Sitcom Fantasy (Mr. Robot)</h2><p>A top-rated Season 2 of <em>Mr. Robot</em> called "eps2.4_m4ster-s1ave.aes" is depicted predominantly in the style of '90s sitcom and even features a cameo by ALF. However, it is later revealed that this laugh-track-filled fantasy is Elliott's (Rami Malek) dream, and that he has been asleep in a hospital after being violently beaten by Ray Heyworth's (Craig Robinson) goons.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="gwXWrYWay8ahPdrjXtHcDA" name="Grease's Beauty School Drop-Out.jpg" alt="Beauty School Dropout scene from Grease" src="https://cdn.mos.cms.futurecdn.net/gwXWrYWay8ahPdrjXtHcDA.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Paramount Pictures)</span></figcaption></figure><h2 id="beauty-school-dropout-grease">Beauty School Dropout (Grease)</h2><p>In the 1978 movie musical <em>Grease</em>, Frenchie (Didi Conn) is encouraged to put her cosmetology career on hold and go back to high school by an unexpected person, Frankie Avalon, with a dreamy number called "Beauty School Dropout.'</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="VJGA9xDCsZmVrN6kD5fh96" name="dreammleftovers" alt="Scene from a crazy dream sequence in The Leftovers" src="https://cdn.mos.cms.futurecdn.net/VJGA9xDCsZmVrN6kD5fh96.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO)</span></figcaption></figure><h2 id="kevin-becomes-an-assassin-the-leftovers">Kevin Becomes An Assassin (The Leftovers)</h2><p>In Season 2 of <em>The Leftovers</em>, Kevin (Justin Theroux) is told by Virgil (Steven Williams) that the only way to cure his persistent visions of cult leader Patti Levin (Ann Dowd) is to take his own life. This sends him into a bewildering reality in which he is a contract killer assigned to kill Patti, who is a presidential candidate.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="2QXKintBHBNXXu5B7uCh96" name="dreamfly" alt="Scene from a crazy dream sequence in The Fly" src="https://cdn.mos.cms.futurecdn.net/2QXKintBHBNXXu5B7uCh96.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: 20th Century Fox)</span></figcaption></figure><h2 id="ronnie-births-a-maggot-the-fly">Ronnie Births A Maggot (The Fly)</h2><p>At one point in the <a href="https://www.cinemablend.com/streaming-news/horror-movies-that-are-actually-great-date-night-films">tragic romantic thriller</a> that is David Cronenberg's 1986 remake of <em>The Fly</em>, Ronnie (Geena Davis) discovers she is pregnant with the child of Dr. Seth Brundle (Jeff Goldblum), who has been transforming into a half-man, half-insect at this time. Her fear of what could be growing inside of her is personified in a nightmare in which, instead of a human baby, she gives birth to a giant larva.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="GuUYy6F8UFVqKhovbJL786" name="dreamcommunity" alt="Scene from a crazy dream sequence in Community" src="https://cdn.mos.cms.futurecdn.net/GuUYy6F8UFVqKhovbJL786.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="jeff-lives-a-g-i-joe-fantasy-community">Jeff Lives A G.I. Joe Fantasy (Community)</h2><p>The <a href="https://www.cinemablend.com/television/2492772/the-8-best-community-episodes-to-stream-once-it-comes-to-netflix">best episodes of <em>Community</em></a> experiment with different genres, such as the time the series put the cast in the world of the '80s-era <a href="https://www.cinemablend.com/television/the-75-best-animated-TV-shows-of-all-time">beloved animated series</a>, <em>G.I. Joe: A Real American Hero</em>. The action-packed, cartoon setting of "G.I. Jeff" is revealed to be a fantasy Jeff Winger (Joel McHale) has created to cope with turning 40.  </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="bKJKrhxC4QbTeHcpCXqZ56" name="dreameraserhead" alt="Scene from a crazy dream sequence in Eraserhead" src="https://cdn.mos.cms.futurecdn.net/bKJKrhxC4QbTeHcpCXqZ56.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Libra Films)</span></figcaption></figure><h2 id="henry-loses-his-head-eraserhead">Henry Loses His Head (Eraserhead)</h2><p>In <em>Eraserhead</em>, Henry (Jack Nantz) has a nightmare in which his head falls off his neck, where a new head resembling his mutant child pops out to replace it. Of course, this dream sequence is no more bizarre than anything else that happens in David Lynch's perplexing 1977 debut feature.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="TegpECgBVSJv4QrMhwV986" name="dreamdickvandyke" alt="Scene from a crazy dream sequence in The Dick van Dyke Show" src="https://cdn.mos.cms.futurecdn.net/TegpECgBVSJv4QrMhwV986.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="rob-suspects-there-is-an-alien-invasion-the-dick-van-dyke-show">Rob Suspects There Is An Alien Invasion (The Dick Van Dyke Show)</h2><p>In a classic episode of <em>The Dick Van Dyke Show</em> called “It May Look Like a Walnut,” Rob Petrie (Van Dyke) watches an <a href="https://www.cinemablend.com/news/2493794/independence-day-riveting-alien-invasion-movies-and-where-to-stream-or-rent-them-online">alien invasion movie</a> involving extraterrestrial walnuts and otherworldly visitors without thumbs. The next day, his life begins to resemble the film's plot, until he wakes up that night to discover it was all a dream.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="WoTXkHCrXx8SzZvQUqt5gY" name="waynes 2.jpg" alt="Dana Carvey and Mike Myers in Wayne's World 2" src="https://cdn.mos.cms.futurecdn.net/WoTXkHCrXx8SzZvQUqt5gY.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Paramount)</span></figcaption></figure><h2 id="wayne-meets-jim-morrison-wayne-s-world-2">Wayne Meets Jim Morrison (Wayne's World 2)</h2><p>The plot of the hit 1993 <a href="https://www.cinemablend.com/streaming-news/every-movie-based-on-snl-characters-ranked"><em>SNL</em> movie</a> <em>Wayne's World 2</em>, in which Wayne Campbell (Mike Myers) and Garth Algar (Dana Carvey) put on their own concert, is set in motion when Wayne dreams he is in a desert where he meets the spirit of The Doors frontman, Jim Morrison (Michael Nickles).</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="TdTLgXRs9ry93BHnqihd86" name="dreamfrasier" alt="Scene from a crazy dream sequence in Frasier" src="https://cdn.mos.cms.futurecdn.net/TdTLgXRs9ry93BHnqihd86.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Paramount)</span></figcaption></figure><h2 id="frasier-is-visited-by-sigmund-freud-frasier">Frasier Is Visited By Sigmund Freud (Frasier)</h2><p>In the Season 4 <em>Frasier</em> episode "The Impossible Dream," the eponymous therapist and radio host (played by Kelsey Grammer) has a suggestive dream about his effeminate colleague, Gil Chesterson (Edward Hibbert). He eventually determines the dream is no more than a task his subconscious gave himself to satisfy his currently unchallenging career, but the episode ends with an even more confusing nighttime encounter with his idol, Sigmund Freud, who joins him in his bed and implies a request for intimacy.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="CpTektWzkd8B8YtrjnnixG" name="dreamburbs" alt="Tom Hanks laying on a giant barbecue pit in The 'Burbs" src="https://cdn.mos.cms.futurecdn.net/CpTektWzkd8B8YtrjnnixG.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Universal)</span></figcaption></figure><h2 id="ray-gets-cooked-the-burbs">Ray Gets Cooked (The 'Burbs)</h2><p>In 1989's <em>The 'Burbs</em>, family man Ray (Tom Hanks) initially refuses to believe that his neighbors could actually be the murderous cult that other locals suspect they are. However, he does reach a breaking point when he dreams that they tear through his house with a chainsaw and sacrifice him on a giant barbecue pit.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="kerBAqML2QD6GEozTT9F76" name="dreamcosby" alt="Scene from a crazy dream sequence in The Cosby Show" src="https://cdn.mos.cms.futurecdn.net/kerBAqML2QD6GEozTT9F76.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="cliff-s-muppet-filled-nightmare-the-cosby-show">Cliff's Muppet-Filled Nightmare (The Cosby Show)</h2><p>One of the weirdest episodes of <em>The Cosby Show</em> involves Cliff Huxtable (Bill Cosby) dreaming that the Muppets have taken over his life.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="rTfZieYBau8TNgiPCvCs96" name="dreamjunior" alt="Scene from a crazy dream sequence in Junior" src="https://cdn.mos.cms.futurecdn.net/rTfZieYBau8TNgiPCvCs96.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Universal)</span></figcaption></figure><h2 id="alex-gives-birth-to-his-doppelganger-junior">Alex Gives Birth To His Doppelganger (Junior)</h2><p>Arnold Schwarzenegger playing a man who becomes pregnant is a pretty intriguing concept on its own. However, things get especially bizarre in 1994's <em>Junior</em> when the actor's character dreams that he has given birth to the spitting image of himself.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="MmcMcQ6BR4Uwmx9GyGWsC6" name="dreamfullhouse" alt="Scene from a crazy dream sequence in Full House" src="https://cdn.mos.cms.futurecdn.net/MmcMcQ6BR4Uwmx9GyGWsC6.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros. Television)</span></figcaption></figure><h2 id="d-j-s-sat-disaster-full-house">D.J.'s SAT Disaster (Full House)</h2><p>In a Season 6 episode of <em>Full House</em>, D.J. Tanner's (Candace Cameron Bure) stress over the upcoming SATs culminates in a nightmare in which <em>Wheel of Fortune</em>'s Vanna White appears to inform her that she has failed the test and will go to Clown University. </p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ I Just Found Out Candace Cameron Bure Was Introduced To Her Husband By Dave Coulier, And I Love The Full House Star’s Sweet Exchange On Her Anniversary ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/i-just-found-out-candace-cameron-bure-was-introduced-to-her-husband-by-dave-coulier-and-i-love-the-full-house-stars-sweet-exchange-on-her-anniversary</link>
                                                                            <description>
                            <![CDATA[ Still bringing those heartwarming moments. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">n45FRtMXoygwKJPAWyxP87</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/9Uxu4MMvuew9jJW9yLvH5f-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Tue, 24 Jun 2025 16:57:18 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Heidi Venable ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/w7HQ9MvRSDd7diNpTmruW9.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Heidi Venable is a Content Producer for CinemaBlend. She started freelancing for the site in 2020 and officially came on board in 2021. Her job entails writing news stories and TV reactions from some of her favorite prime-time shows like Grey&#039;s Anatomy and The Bachelor. She graduated from Louisiana Tech University with a degree in Journalism and worked in the newspaper industry for almost two decades in multiple roles including Sports Editor, Page Designer and Online Editor.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Into&lt;/strong&gt;: Heidi grew up in the 1990s, and her tastes strongly reflect that. She can (and does) quote Friends constantly, enjoys a good West Wing binge, thinks Can&#039;t Hardly Wait was the most influential movie of her life and finds solace in 311 concerts. On Sundays during football season, she can be found cheering on the New Orleans Saints with her husband and two daughters. Who Dat! She loves to read but usually settles for a pop culture podcast, and thinks the best weekends are spent cooking and playing cards with friends and family, preferably with some UFC fights or other sporting event on TV.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Excited About Right Now&lt;/strong&gt;: Football season, Pumpkin Spice Lattes and everything related to fall and cooler weather. The Game of Roses podcast and all things The Bachelor, and new episodes of Grey&#039;s Anatomy, Love Is Blind, The Voice, OMITB and more.&amp;nbsp;&lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/9Uxu4MMvuew9jJW9yLvH5f-1280-80.jpg">
                                                            <media:credit><![CDATA[Micahel Yarish/Netflix]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Candace Cameron Bure as DJ looks at Dave Coulier as Joey on Fuller House.]]></media:description>                                                            <media:text><![CDATA[Candace Cameron Bure as DJ looks at Dave Coulier as Joey on Fuller House.]]></media:text>
                                <media:title type="plain"><![CDATA[Candace Cameron Bure as DJ looks at Dave Coulier as Joey on Fuller House.]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/9Uxu4MMvuew9jJW9yLvH5f-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>It’s been enjoyable as someone who grew up watching <em>Full House</em> (and still streams it with my <a href="https://www.cinemablend.com/television/2570432/subscribing-to-hbo-max-what-to-know-about-the-price-options-and-what-the-streaming-service-offers">Max subscription</a>) to see how close its cast remains after all these years. Candace Cameron Bure has a particularly special bond with Dave Coulier, and there’s a good reason — it turns out he introduced her to her husband! This bit of Tanner trivia had eluded me until now, and I can’t get over their sweet social media exchange as Bure celebrated her 29th wedding anniversary.</p><p>Candace Cameron Bure — who continues to appear on the <a href="https://www.cinemablend.com/television/2025-tv-premiere-date-schedule-upcoming-new-returning-shows">2025 TV schedule</a> as part of Great American Family’s slate of movies — posted a tribute to her husband Valeri Bure in celebration of nearly three decades of marriage. She was also sure to thank her former co-star for making it all possible. In an <a href="https://www.instagram.com/p/DLOGLm6hqiR?img_index=1">Instagram post</a>, she wrote:</p><div><blockquote><p>31 years ago we went on our first official date at his practice rink in Fredericton, New Brunswick. [Dave Coulier] introduced us at a charity hockey game in Los Angeles 4 months earlier. 30 years ago on June 20th, we got engaged in Paris. 29 years ago today, June 22nd, we got married. We grew a beautiful family ❤️❤️❤️. Happy anniversary to my love and best friend forever ♥️ 🥂. And this was the song for our first dance 🥰.</p></blockquote></div><p>Dave Coulier — who played the <a href="https://www.cinemablend.com/television/full-house-dave-coulier-reveals-origin-joey-last-name-tanner-family-disapprove">hilariously named Joey Gladstone</a> on <em>Full House</em>, who moved in to help best friend Danny Tanner (Bob Saget) raise his three daughters — seemed to appreciate the shout-out, but he took no credit as he referenced <a href="https://www.cinemablend.com/television/2569751/internet-sleuthing-candace-cameron-bure-share-full-house-met-valeri-husband">the night the Bures met</a>, as he responded:</p><div><blockquote><p>I am SO PROUD of the life you two have built together. And to think that the incredible world of hockey brought it all together. Love you both so much!</p></blockquote></div><p>Why do I feel like the love between these two friends is almost overshadowing her wedding anniversary? No, I’m just kidding (mostly), but Dave Coulier does appear to be the only non-family member to make the cut in Candace Cameron Bure’s post of throwback photos. Check him out on the second slide:</p><div class="instagram-embed"><blockquote class="instagram-media"  data-instgrm-version="6" style="width:99.375%; width:-webkit-calc(100% - 2px); width:calc(100% - 2px);"><p><a href="https://www.instagram.com/p/DLOGLm6hqiR/" target="_blank">A post shared by Candace Cameron Bure (@candacecbure)</a></p><p>A photo posted by  on </p></blockquote></div><p>These pics are so adorable, and 20-year-old CCB and her 22-year-old groom look like babies in their wedding attire! It’s cute to see them celebrating their love alongside their three children (and Dave Coulier) throughout the years.</p><p>Given the huge role that her <em>Full House</em> co-star played in her personal life, it makes even more sense why Candace Cameron Bure said <a href="https://www.cinemablend.com/television/candace-cameron-bure-opened-up-about-dave-coulier-cancer-diagnosis">Dave Coulier’s cancer diagnosis was “devastating”</a> for her. Thankfully, the comedian has since <a href="https://www.cinemablend.com/television/candace-cameron-bure-dave-coulier-wholesome-exchange-after-announced-cancer-free-poopoo-nickname">announced that he’s cancer-free</a> — a fact that was celebrated loud and proud by the oldest of the Tanner daughters.</p><p>Twenty-nine years is quite the accomplishment for Valeri and Candace Cameron Bure, as is the actress’ 39-year friendship with Dave Coulier and the other stars of <em>Full House</em>. If you want to relive that heartwarming Tanner family goodness, <em>Full House</em> is available to stream on Max or with a <a href="https://www.cinemablend.com/television/2570844/subscribing-to-hulu-the-price-whats-included-and-everything-else-to-know">Hulu subscription</a>. You can also catch most of the gang — including Bure and Coulier — on the spinoff <em>Fuller House</em> with your <a href="https://www.cinemablend.com/streaming-news/netflix-subscription-the-plans-the-price-and-whats-included">Netflix subscription</a>.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ How Full House Stars’ Parents Reacted When Bob Saget Told Dirty Jokes Around The Child Actors ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/how-full-house-stars-parents-reacted-bob-saget-dirty-jokes-around-child-actors</link>
                                                                            <description>
                            <![CDATA[ Sounds about right. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">MccAURtjvTWLvJukDHtdyK</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/BsKJCJ7VcBrYNYaqUUnRb9-1280-80.png" type="image/png" length="0"></enclosure>
                                                                        <pubDate>Tue, 24 Jun 2025 00:17:10 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Television]]></category>
                                                                                                <author><![CDATA[ mick.joest@CinemaBlend.com (Mick Joest) ]]></author>                    <dc:creator><![CDATA[ Mick Joest ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/4dnBaqggYBopRBZtr5dHzg.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Mick Joest is a Content Producer for CinemaBlend with his hand in an eclectic mix of television goodness. Star Trek is his main jam, but he also regularly reports on happenings in the world of Star Trek, WWE, Doctor Who, 90 Day Fiancé, Quantum Leap, and Big Brother. He graduated from the University of Southern Indiana with a degree in Journalism and a minor in Radio and Television. He&#039;s great at hosting panels and appearing on podcasts if given the chance as well.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Into&lt;/strong&gt;: Most everything Mick reports on because he&#039;s passionate and a fan of the subject. He really loves interviewing people and getting the bigger answers to questions. Outside of work, he&#039;s a sports fan who supports the Indiana Pacers, as well as the New England Patriots.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Excited About Right Now&lt;/strong&gt;: Mick is excited for the tentative ending of the writer&#039;s strike and for more of his favorite shows like Quantum Leap and Star Trek: Strange New Worlds to finish out their in-development seasons.&amp;nbsp;&lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/png" url="https://cdn.mos.cms.futurecdn.net/BsKJCJ7VcBrYNYaqUUnRb9-1280-80.png">
                                                            <media:credit><![CDATA[ABC]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[bob saget on full house]]></media:description>                                                            <media:text><![CDATA[bob saget on full house]]></media:text>
                                <media:title type="plain"><![CDATA[bob saget on full house]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/BsKJCJ7VcBrYNYaqUUnRb9-1280-80.png" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>It's been three years since the <a href="https://www.cinemablend.com/television/full-house-star-bob-saget-is-dead-at-65">sudden passing of comedian Bob Saget</a>, but his spirit remains in the hearts of fans everywhere, but especially those of the <em>Full House</em> stars keeping him in the conversation with their hilarious stories. Jodie Sweetin and Andrea Barber have helped pull back that curtain over the years, such as discussing how he <a href="https://www.cinemablend.com/television/why-full-house-bob-saget-struggled-with-being-americas-favorite-dad-according-to-jodie-sweetin-andrea-barber">struggled with being "America's Dad</a>" while also performing NSFW stand-up. I can't help but laugh at the actress' stories about their parents reacting to Saget telling a dirty joke on set. </p><p>John Stamos and Lori Loughlin were guests on a recent live episode of Sweetin and Barber's throwback podcast <a href="https://podcasts.apple.com/us/podcast/minisode-listen-to-the-live-event-part-1/id1698513192?i=1000713504483"><em>How Rude, Tanneritos!</em></a>, and the former discussed his parents visiting the set to watch him film episodes on the nights before the studio audience arrived. Sweetin and Barber added that, as child actors, their parents were legally required to be there whenever they worked, and how they'd react when Bob Saget told an off-color joke during filming: </p><div><blockquote><p>Well, you would see our moms, our moms would be up in the bleachers. in the audience on non-audience night. So it was just the moms and a few stand-ins. But they would stand up, and they'd be like, ‘Bob!’ That's when you knew. </p></blockquote></div><p>Stamos and Loughlin laughed and went on to explain that Bob Saget's jokes often ended with the parents complaining and the adult cast getting lectured by producers. It's not the first time we've heard this, as the Olsen Twins, even as young as they were during the show, remember <a href="https://www.cinemablend.com/television/mary-kate-ashley-olsen-confirmed-bob-saget-inappropriate-full-house">the adult cast being pretty inappropriate</a>. </p><div class="product"><a data-dimension112="6c7acef3-938e-4058-81d9-f5f505b8ee1c" data-action="Deal Block" data-label="Hulu: 30-Day Free Trial" data-dimension48="Hulu: 30-Day Free Trial" href="http://click.linksynergy.com/fs-bin/click?id=kXQk6%2aivFEQ&offerid=1589248.1591&type=3&subid=0&u1=hawk-custom-tracking" target="_blank" rel="nofollow"><figure class="van-image-figure "  ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1414px;"><p class="vanilla-image-block" style="padding-top:99.29%;"><img id="bhyqudLBfMw7KeCkdxjRBL" name="Hulu logo.png" caption="" alt="" src="https://cdn.mos.cms.futurecdn.net/bhyqudLBfMw7KeCkdxjRBL.png" mos="" align="middle" fullscreen="" width="1414" height="1404" attribution="" endorsement="" credit="" class=""></p></div></div></figure></a><p><a href="https://click.linksynergy.com/fs-bin/click?id=kXQk6%2aivFEQ&offerid=1589248.1591&type=3&subid=0&u1=hawk-custom-tracking" target="_blank" rel="nofollow" data-dimension112="6c7acef3-938e-4058-81d9-f5f505b8ee1c" data-action="Deal Block" data-label="Hulu: 30-Day Free Trial" data-dimension48="Hulu: 30-Day Free Trial" data-dimension25=""><strong>Hulu: 30-Day Free Trial</strong></a><strong><br></strong>Snag a <a href="https://www.cinemablend.com/television/2570844/subscribing-to-hulu-the-price-whats-included-and-everything-else-to-know">Hulu subscription</a> and stream <em>Full House</em> today! Both Hulu's Ad-Supported and Ad-Free tiers give subscribers access to everything the platform has to offer, and new and eligible returning customers can enjoy a whole month of the service for free before paying, with plans starting from $9.99 a month.<a class="view-deal button" href="http://click.linksynergy.com/fs-bin/click?id=kXQk6%2aivFEQ&offerid=1589248.1591&type=3&subid=0&u1=hawk-custom-tracking" target="_blank" rel="nofollow" data-dimension112="6c7acef3-938e-4058-81d9-f5f505b8ee1c" data-action="Deal Block" data-label="Hulu: 30-Day Free Trial" data-dimension48="Hulu: 30-Day Free Trial" data-dimension25="">View Deal</a></p></div><p>While the Olsen twins alleged the adult cast as a whole could skew inappropriate, the only other offense John Stamos mentioned on the podcast was that <a href="https://www.cinemablend.com/television/full-houses-dave-coulier-on-that-time-he-farted-in-one-of-the-olsen-twins-faces">Dave Coulier had a "gas problem"</a> when filming. It's not the worst issue in the world, unless you're one of the child actors, who pointed out they were all around eye-level height with his butt at the time. I can imagine it's hard to make it through a scene when you're getting crop-dusted nonstop. </p><div  class="fancy-box"><div class="fancy_box-title">More On Full House</div><div class="fancy_box_body"><figure class="van-image-figure "  ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="ggVG6UXJwDpX8dX8KULNp8" name="Full House 3.jpg" caption="" alt="John Stamos on Full House" src="https://cdn.mos.cms.futurecdn.net/ggVG6UXJwDpX8dX8KULNp8.jpg" mos="" link="" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pinterest-pin-exclude"></p></div></div><figcaption itemprop="caption description" class=""><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><p class="fancy-box__body-text"><a data-analytics-id="inline-link" href="https://www.cinemablend.com/television/full-house-stars-recall-filming-with-donkey-pepper-mill-that-was-sexually-aroused-by-john-stamos">Full House Stars Recall Filming With Donkey ‘Pepper Mill’ That Was Sexually Aroused By John Stamos</a></p></div></div><p>Is this the kind of behavior that would fly on the set of a show premiering on the <a href="https://www.cinemablend.com/television/2025-tv-premiere-date-schedule-upcoming-new-returning-shows">2025 TV schedule</a>? One certainly has to wonder, but it's not like producers didn't know what they were getting into when they brought in Bob Saget. The <a href="https://www.cinemablend.com/movies/stand-up-comedians-who-passed-way-too-soon">gone-too-soon comedian</a> was performing stand-up for a decade prior to landing the gig as Danny Tanner on <em>Full House</em>, so it's not like his fake offspring were his core audience.</p><p>It's also worth noting that even if he might've ruffled the feathers of parents, Bob Saget was still beloved by the cast. We've heard many <a href="https://www.cinemablend.com/television/full-houses-dave-coulier-shares-bob-sagets-a-cut-it-out-joke-that-can-never-be-topped">hilarious stories about him from co-stars like Dave Coulier</a> over the years that mix in his penchant for inappropriate jokes and his overall ability to make others laugh. To be honest, I'd love to see one of those dirty jokes he told in the midst of filming, assuming footage of it exists. </p><p><em>Full House</em> is streaming on Hulu, in case anyone feels the urge to revisit some of their favorite episodes. Just don't go in expecting some raunchy humor, though there are Bob Saget stand-up specials where one could hear that. </p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ Candace Cameron Bure Makes A Rare Comment About The Olsen Twins, Including How They Contributed To Full House’s Success ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/candace-cameron-bure-rare-comment-about-mary-kate-ashley-olsen-how-they-contributed-full-houses-success</link>
                                                                            <description>
                            <![CDATA[ Do they still keep in touch? ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">ds3b7jFT39NGoCdFr8z7gN</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/3TtjQJV7yVpJynePh9FcoL-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Sat, 14 Jun 2025 18:26:13 +0000</pubDate>                                                                                                                                <updated>Sat, 14 Jun 2025 22:21:03 +0000</updated>
                                                                                                                                            <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Heidi Venable ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/w7HQ9MvRSDd7diNpTmruW9.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Heidi Venable is a Content Producer for CinemaBlend. She started freelancing for the site in 2020 and officially came on board in 2021. Her job entails writing news stories and TV reactions from some of her favorite prime-time shows like Grey&#039;s Anatomy and The Bachelor. She graduated from Louisiana Tech University with a degree in Journalism and worked in the newspaper industry for almost two decades in multiple roles including Sports Editor, Page Designer and Online Editor.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Into&lt;/strong&gt;: Heidi grew up in the 1990s, and her tastes strongly reflect that. She can (and does) quote Friends constantly, enjoys a good West Wing binge, thinks Can&#039;t Hardly Wait was the most influential movie of her life and finds solace in 311 concerts. On Sundays during football season, she can be found cheering on the New Orleans Saints with her husband and two daughters. Who Dat! She loves to read but usually settles for a pop culture podcast, and thinks the best weekends are spent cooking and playing cards with friends and family, preferably with some UFC fights or other sporting event on TV.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Excited About Right Now&lt;/strong&gt;: Football season, Pumpkin Spice Lattes and everything related to fall and cooler weather. The Game of Roses podcast and all things The Bachelor, and new episodes of Grey&#039;s Anatomy, Love Is Blind, The Voice, OMITB and more.&amp;nbsp;&lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/3TtjQJV7yVpJynePh9FcoL-1280-80.jpg">
                                                            <media:credit><![CDATA[Max]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[One of the Olsen twins as Michelle and Candace Cameron Bure as DJ on a Season 7 episode of Full House.]]></media:description>                                                            <media:text><![CDATA[One of the Olsen twins as Michelle and Candace Cameron Bure as DJ on a Season 7 episode of Full House.]]></media:text>
                                <media:title type="plain"><![CDATA[One of the Olsen twins as Michelle and Candace Cameron Bure as DJ on a Season 7 episode of Full House.]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/3TtjQJV7yVpJynePh9FcoL-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p><em>Full House</em>’s original run on ABC may have ended nearly 30 years ago, but it remains a beloved family sitcom (with a <a href="https://www.cinemablend.com/television/retro-tv-theme-songs-that-still-slap">pretty catchy theme song</a>). There are several possible reasons the show has stood the test of time, and cast members have discussed this for  years. Candace Cameron Bure has her own unique theory involving Mary-Kate and Ashley Olsen, as she made a rare comment about her on-screen sisters.</p><p>Candace Cameron Bure was a guest on the <a href="https://podcasts.apple.com/us/podcast/unmasked-with-candace-cameron-bure/id1658407772?i=1000712236550"><em>Hey Dude… The 90s Called</em> podcast</a>, where she discussed why her sitcom gained the popularity that others (including hosts David Lascher and Christine Taylor’s <em>Hey Dude</em>) did not. Bure pointed out that <em>Full House</em> broke the mold in a big way with the Olsen twins, saying:</p><div><blockquote><p>We were one of the first people to have a baby on the show that actually stayed a baby, like, grew up on the show. Because usually they have, like, a baby and then cut to a 5-year-old. It was the first show that had Mary-Kate and Ashley on at 9 months old and they stayed on the show for eight years, so you literally saw them grow up. </p></blockquote></div><p>It seems so simple, but it’s a great point. Usually, when there’s a baby on a series, you may continue to see that character, but the actor (or actors) portraying them change as the baby gets older. For the Olsen twins, we saw them at 9 months, and they grew naturally with the show for eight years.</p><p>The Great American Family actress also said the non-traditional family aspect struck a chord with viewers — three girls being raised without a mom (by one of the <a href="https://www.cinemablend.com/movies/movie-tv-dads-we-would-be-proud-to-have">best TV dads</a> ever) resonated with families without two parents or with kids living with grandparents, etc. There’s also the fact that Candace Cameron Bure found <em>Full House</em> — available to stream with a <a href="https://www.cinemablend.com/television/2570844/subscribing-to-hulu-the-price-whats-included-and-everything-else-to-know">Hulu subscription</a> or <a href="https://www.cinemablend.com/television/2570432/subscribing-to-hbo-max-what-to-know-about-the-price-options-and-what-the-streaming-service-offers">Max subscription</a> — “so sweet” when she <a href="https://www.cinemablend.com/television/candace-cameron-bure-watched-full-house-understand-whyshows-not-off-air-35-years">watched for the first time in ages</a>.</p><p>The actress went on to talk about her relationship with Ashley and Mary-Kate Olsen and admitted that despite playing sisters on TV for eight years, they don’t talk all that often. In CCB’s words:</p><div><blockquote><p>I haven’t talked to them. We don’t keep in touch often. Like once a year, it’s like the anniversary of [Bob Saget’s] death, which sounds so morbid, but it’s beautiful in that we kind of always have a text moment. It’s about once a year, but other than that, they’re really private people. </p></blockquote></div><p>While Candace Cameron Bure can still be found in projects on the <a href="https://www.cinemablend.com/television/2025-tv-premiere-date-schedule-upcoming-new-returning-shows">2025 TV schedule</a>, Mary-Kate and Ashley Olsen <a href="https://www.cinemablend.com/movies/child-actors-that-left-hollywood-behind-and-what-happened-to-them">left Hollywood behind them</a> and became big players in the fashion industry. The 10-year age difference between the actresses is also a valid reason for the TV sisters not keeping in touch. </p><p>While Bure was a young adult when <em>Full House</em> ended, the Olsen sisters were just 8 (even younger than Bure when FH started), and <a href="https://www.cinemablend.com/streaming-news/full-houses-jodie-sweetin-shared-the-best-reasoning-for-why-the-olsen-twins-didnt-return-for-netflixs-fuller-house">Jodie Sweetin made a really good point</a> when she asked how much anybody remembers about life before 8 years old?</p><p>Still, Candace Cameron Bure called Mary-Kate and Ashley “lovely people” and said when they all <a href="https://www.cinemablend.com/television/bob-sagets-pals-had-a-punk-rock-shiva-after-his-fancy-funeral-with-dave-chapelle-john-mayer-what-looks-to-be-the-olsen-twins-and-more">reunited for Bob Saget’s funeral</a>, it was “so comfortable” being around them: “Like picking up wherever it left off.”</p><p>Sounds like real-life sisters to me!</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ Why Full House’s Bob Saget ‘Struggled’ With Being America’s Favorite Dad, According To Co-Stars Jodie Sweetin And Andrea Barber ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/why-full-house-bob-saget-struggled-with-being-americas-favorite-dad-according-to-jodie-sweetin-andrea-barber</link>
                                                                            <description>
                            <![CDATA[ I get it... ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">uQVKfX9orDW8sJ6kY46bQb</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/BsKJCJ7VcBrYNYaqUUnRb9-1280-80.png" type="image/png" length="0"></enclosure>
                                                                        <pubDate>Sat, 07 Jun 2025 22:21:00 +0000</pubDate>                                                                                                                                <updated>Sat, 07 Jun 2025 22:32:39 +0000</updated>
                                                                                                                                            <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Adrienne Jones ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/ttBJtAZ7vqCe9Tp4BQiALo.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Adrienne Jones is a Senior Content Producer at CinemaBlend, and started at the site in the fall of 2015. In addition to writing and editing stories on a variety of different topics, she also spends her work days trying to find new ways to write about the many romantic entanglements that fictional characters find themselves in on TV shows. She graduated from Mizzou with a degree in Photojournalism.&amp;nbsp;&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Into&lt;/strong&gt;: Adrienne will maintain until her dying day (and probably well after that, if possible) that 9 to 5 is one of the best movies ever made, though she also holds a special place in her heart for Auntie Mame, Office Space, and Bridesmaids. This may make it sound like her life and entertainment choices are only giggle-focused (not totally untrue), but she also enjoys warm-hearted dramadies (Gilmore Girls, Lovesick), creepy stuff (The X-Files, Evil), sci-fi/fantasy (most Star Treks, The Witcher), romantic shows (Bridgerton, Sweet Magnolias, Outlander), and the occasional drama (The Wire, Vikings: Valhalla). Adrienne likes cooking, but also ordering delivery so that strangers can be forced to bring her food, and believes that most days are incomplete without chocolate, reading, and staring out the window to see if any wild animals are engaging in shenanigans.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;Yennefer&#039;s apprentice, Gilmore Girl; will Vulcan nerve pinch pretty much anyone if prompted with cheese...Yes, even Jamie Fraser.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Excited About Right Now&lt;/strong&gt;: Weather and raccoons that only come out at night!&lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/png" url="https://cdn.mos.cms.futurecdn.net/BsKJCJ7VcBrYNYaqUUnRb9-1280-80.png">
                                                            <media:credit><![CDATA[ABC]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[bob saget on full house]]></media:description>                                                            <media:text><![CDATA[bob saget on full house]]></media:text>
                                <media:title type="plain"><![CDATA[bob saget on full house]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/BsKJCJ7VcBrYNYaqUUnRb9-1280-80.png" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>Even if you didn’t experience the early 1990s first hand, you are probably well aware of one of the big television success stories that thrived in that decade: <em>Full House</em>. The hit, TGIF programming block family sitcom was (and still is) adored by millions of people who grew up watching the series back in the day, and was even so popular in its eight-season run that a <a href="https://www.cinemablend.com/television/full-houses-jodie-sweetin-andrea-barber-weighed-in-another-spinoff-challenge-making-it"><u>spinoff show for Netflix had its own successful run</u></a> of five seasons. Stars Andrea Barber and Jodie Sweetin recently reminisced about their experiences with their <a href="https://www.cinemablend.com/television/final-report-on-bob-sagets-death-released-with-information-redacted-following-judges-decision"><u>late co-star Bob Saget</u></a>, and noted that he “struggled” with being known as America’s Dad.</p><h2 id="what-did-jodie-sweetin-and-andrea-barber-say-about-bob-saget-s-issues-with-being-known-as-america-s-dad">What Did Jodie Sweetin And Andrea Barber Say About Bob Saget’s Issues With Being Known As America’s Dad?</h2><p><em>Full House</em> excelled on ABC for long enough that the comedy launched catch phrases and the careers of stars Jodie Sweetin, Candace Cameron Bure, and Mary-Kate and Ashley Olsen as the daughters of Bob Saget’s widowed Danny Tanner. Andrea Barber (who portrayed annoying Tanner family friend, Kimmy) and Sweetin now host a rewatch podcast, <a href="https://www.iheart.com/podcast/1119-how-rude-tanneritos-118613484/episode/minisode-dedicated-to-bob-saget-278251145/"><u><em>How Rude, Tanneritos</em></u></a>, and a recent episode saw the duo dedicate some time to talking about Bob Saget.</p><p>For both actresses (who’ve opened up about things like <a href="https://www.cinemablend.com/television/full-house-jodie-sweetin-andrea-barber-reveal-pam-tanner-family-detail-they-wish-handled-differently"><u>aspects of the Tanner family they wish were done better</u></a> and which <a href="https://www.cinemablend.com/television/full-houses-jodie-sweetin-and-andrea-barber-cant-stand-one-of-earliest-episodes"><u>early </u><u><em>Full House</em></u><u> episode they hate</u></a>) this project marks either the first time they’ve watched the show that made them famous, or the first time they’ve rewatched. This naturally means that it brings up lots of memories of working on the sitcom and of the <a href="https://www.cinemablend.com/television/full-house-cast-celebrates-35th-anniversary-with-lots-of-throwback-pics-and-bob-saget-love"><u>large, continually close-knit cast</u></a>. Barber noted that she can now understand why so many fans looked up to Saget, and said:</p><div><blockquote><p>Yeah, I can definitely see why America views him as America's Dad. Like, he is the dad that a lot of people didn't have or wish that they had. [I] absolutely see that for sure.</p></blockquote></div><p>Though Danny was a disco-loving neat freak, he was also a perfectly supportive dad whose positive qualities far outweighed any of his decidedly unhip tendencies. So, it was pretty easy to love Danny as a parent, especially if you were a kid watching who was missing that fatherly touch from your life.</p><p>However, while Saget was by all accounts a good dude with <a href="https://www.cinemablend.com/television/full-house-dave-coulier-how-cast-preserves-bob-saget-memory"><u>a lot of loving friends</u></a> and <a href="https://www.cinemablend.com/television/bob-sagets-widow-kelly-rizzo-reflects-on-their-fun-vacations-together-with-sweet-clips"><u>an amazing family</u></a>, the career stand up comedian had fostered a <em>very</em> different persona on stage in comedy clubs. And this is what’s led Sweetin and Barber to feel he had some trouble with being seen only as a cuddly, sweet, and somewhat bland nice guy. Sweetin continued:</p><div><blockquote><p>Sure, and I think, you know, Bob kind of struggled with that title. I think over the years. It was great when he was doing the show and you know, he had America's Funny Home Videos, but it was also, I think, really frustrating for him as a comic. Because we all know how Bob's comedy is, and it's, you know, relatively blue and adult and ridiculous and unhinged. It became really hard to be that person and this other person. People either thought that one or the other was who you really were and not that you could be multifaceted or be a really ridiculous, you know, funny, dirty stand-up comic and also like have a side that is a family guy.</p></blockquote></div><p>With the main thing that led to his fame being his stint on a family show, it does make a lot of sense that Saget would have been stuck in that mold and not know how to really get audiences to understand what seemed like two completely different sides to his personality. As Barber noted:</p><div><blockquote><p>Two things can exist, multiple things can exist at once. Yes, but people want to pigeonhole you or typecast you.</p></blockquote></div><p>Luckily, those somewhat hard feelings didn’t persist. Saget (who <a href="https://www.cinemablend.com/television/full-house-star-bob-saget-explains-what-inspired-his-change-in-perspective-on-death-and-aging-in-posthumous-interview"><u>shared his own thoughts on death and aging</u></a> in an interview that turned out to be one of his last) had come to terms with his dual legacy as one of TV’s most beloved dads and a truly off the wall comedian enough to spend a good amount of time on <em>Fuller House</em> during its run. As Sweetin added:</p><div><blockquote><p>But I think, as he got older, after he kind of I think went through — and I feel like we all went through that period of like you're just like, ‘Oh my god, I wish something else, you know, and then all of a sudden you go, ‘Oh, wait, actually this is really great. And I think once he, once he had some perspective and got to kind of go and do more of the stuff he wanted to do creatively, I think he really came back to it and was like, ‘Oh, actually this is really who I am. And he just became more Danny Tanner as he got older.</p></blockquote></div><p>I’m sure knowing that Bob Saget became so comfortable with the Danny Tanner side of his actual personality that he was able to fully embrace it makes all the fans who still think of him as America’s Dad very happy.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ Rating 32 Sitcom Families By How Well They Got Along ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/rating-sitcom-families-by-how-well-they-got-along</link>
                                                                            <description>
                            <![CDATA[ I got a lot of problems with you people! ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">iMS8ueni5HEmqFvgKtWDDD</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/P4944QX9r2ELioeWjUC8VN-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Fri, 23 May 2025 20:32:00 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Maggie Sheck ]]></dc:creator>                                                                                                        <dc:description><![CDATA[ null ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/P4944QX9r2ELioeWjUC8VN-1280-80.jpg">
                                                            <media:credit><![CDATA[ABC]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Modern Family]]></media:description>                                                            <media:text><![CDATA[Modern Family]]></media:text>
                                <media:title type="plain"><![CDATA[Modern Family]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/P4944QX9r2ELioeWjUC8VN-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p><a href="https://www.cinemablend.com/television/100-best-tv-sitcoms-of-all-time-ranked"><u>Great sitcom</u></a> families come in all shapes and sizes when it comes to the expansive landscape. From animated favs to semi-autobiographical cranktakorous comedians, and even classic Hollywood iconic fams, all show up, good, bad or ugly. Regardless of their grade or feelings for one another, each brood left an indelible mark on the television genre. Wherever you stand within your family tree, this list is for the fathers, mothers, step-parents, kids, siblings, cousins and much more.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="B24NQ5pwZy9APjEdZVHzkZ" name="The Addams Family Streaming-1.jpg" alt="Carolyn Jones, John Astin, Jackie Coogan, Ted Cassidy, Blossom Rock, Lisa Loring, and Ken Weatherwax in The Addams Family" src="https://cdn.mos.cms.futurecdn.net/B24NQ5pwZy9APjEdZVHzkZ.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="the-addams-the-addams-family-5-5">The Addams - The Addams Family 5/5</h2><p>Though they can be considered creepy and kooky, the Addams remain as relevant as ever in pop culture. Starting as a single-panel <em>New Yorker</em> comic strip, the blended oddballs continue to showcase true love through dark and dismal ways. The success of these longstanding family unit vibes is due to one of the <a href="https://www.cinemablend.com/movies/best-movie-couples-not-in-rom-coms"><u>best couples (outside of rom-coms)</u></a>, Gomez and Morticia, and their unwavering love and pride.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="T2BFEEeM9xC4ucpNrS6SXH" name="The Simpsons.jpg" alt="The Simpsons couch" src="https://cdn.mos.cms.futurecdn.net/T2BFEEeM9xC4ucpNrS6SXH.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: 20th Television)</span></figcaption></figure><h2 id="the-simpsons-the-simpsons-4-5">The Simpsons - The Simpsons 4/5</h2><p>The long-running cartoon has become a recognizable pop culture staple worldwide. Even if Homer, Marge, Bart, Lisa and Maggie aren’t the Cleavers of the past thirty years, they still show up for one another however they can. Realistically, though, <a href="https://www.cinemablend.com/television/times-marge-shined-the-simpsons"><u>Marge has and continues to be the anchor</u></a> of the Simpson family dynamics.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="v5opHJzMAYPS8axZisYLxn" name="andy griffith show" alt="Opie Aunt Bee and Andy Taylor in the kitchen on The Andy Griffith show." src="https://cdn.mos.cms.futurecdn.net/v5opHJzMAYPS8axZisYLxn.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="the-taylors-the-andy-griffith-show-5-5">The Taylors - The Andy Griffith Show 5/5</h2><p>Mayberry, North Carolina, wouldn’t be the same without the Taylors, in my opinion. Andy, Aunt Bee and Opie paved the way wholesomely for many other families, of any shape or size, in the sitcom landscape. Now and again, though, small conflicts would arise between the trio (I still can’t get over the Opie, slingshot and bird episode) that would get addressed head-on and with care.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="teVwypzMqknhwQfJNnCZAg" name="all in the family.jpg" alt="Carroll O'Connor and Jean Stapleton on All in the Family" src="https://cdn.mos.cms.futurecdn.net/teVwypzMqknhwQfJNnCZAg.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="the-bunkers-all-in-the-family-3-5">The Bunkers - All In The Family 3/5</h2><p>The Bunkers live in a working-class Queens home fueled by loud opinions, generational clashes, and sharp-tongued debates. Archie’s old-school views and Edith’s unwavering sweetness lend to the frequently boisterous home. Though daughter Gloria and husband, Mike, are no strangers to stirring the pot, either.  Underneath it all lies a stubborn but constant love for each other amid all the high-strung dynamics.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Z3EqDJ5sjsspWcXna4BMEP" name="the jeffersons" alt="Louise and George Jefferson sitting on the couch in The Jeffersons." src="https://cdn.mos.cms.futurecdn.net/Z3EqDJ5sjsspWcXna4BMEP.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="the-jeffersons-the-jeffersons-4-5">The Jeffersons - The Jeffersons 4/5</h2><p>The titular unit first starred on <em>All in the Family</em> as the Bunkers' neighbors. Not long after did George, Louise and their family moved on up. The Jeffersons showcased a pretty average but caring reflection of familial dynamics–dad’s arrogance clashed with mom’s calm, while their son, Lionel, tried to be a voice of reason. Along with the trio’s inner workings, extended relatives were added into the mix in a humorous but heartfelt way.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="qzHLxWrFzSUAFSB5DBE7ik" name="bewitched tabitha.jpg" alt="Samantha and Tabitha from Bewitched" src="https://cdn.mos.cms.futurecdn.net/qzHLxWrFzSUAFSB5DBE7ik.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="the-stephens-bewitched-3-5">The Stephens - Bewitched 3/5</h2><p>Though <em>Bewitched</em> was presented as generally lighthearted with a focus on comedic situations, the storylines made the Stephens’ experience some turbulence. Between Samantha’s relatives interfering in her everyday dealings, to Darrin initially doubting her abilities, and even her kiddos stirring the pot, the familial layers ran through a whole gamut.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="NAVHFbgYnQmxg6GFJJ5mtg" name="Sanford and Son.jpg" alt="Redd Foxx and Demond Wilson on Sanford and Son" src="https://cdn.mos.cms.futurecdn.net/NAVHFbgYnQmxg6GFJJ5mtg.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="the-sanfords-sanford-and-son-3-5">The Sanfords - Sanford And Son 3/5</h2><p>Fred and Lamont make up this parent-kid relationship, and while it’s relatively stable, the less-than-stellar communication skills hinder these two from leveling up. Notably, it’s a love-hate vibe between the two, with Fred’s habits and personal beliefs that cause the most trouble in their day-to-day lives.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="u3sGtTW3m2p7d5z8jLrffn" name="Screen Shot 2022-05-27 at 12.44.59 PM.png" alt="The cast of The Munsters" src="https://cdn.mos.cms.futurecdn.net/u3sGtTW3m2p7d5z8jLrffn.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="the-munsters-the-munsters-5-5">The Munsters - The Munsters 5/5</h2><p>Presented as a satirical counterpoint to the other familial shows during the 60s, the spooky eponymous unit was quite loving. Herman and Lily, Frankenstein’s monster and a vampire, respectively, were good-natured parental role models who welcomed open conversations, even when things went haywire.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="eWYZpjU9FaJMxvgGVXCNoX" name="The Dick Van Dyke Show" alt="rob and Laurie dancing in night club in The Dick Van Dyke Show" src="https://cdn.mos.cms.futurecdn.net/eWYZpjU9FaJMxvgGVXCNoX.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: YouTube)</span></figcaption></figure><h2 id="the-petries-the-dick-van-dyke-show-4-5">The Petries - The Dick Van Dyke Show 4/5 </h2><p>The veteran black and white trio balances everyday life with Hollywood dealings. Filled with quick wit, heartfelt moments, and the occasional misstep (often turned laugh), they face the ups and downs of everyday personal and professional issues as a unit. The Petries are a great example of running a home with grace, humor, and even a little song and dance when needed.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="HC9xxjhtDxUXvq5YNW4ayW" name="The Routine, Friends.jpg" alt="Monica and Ross doing their routine in Friends." src="https://cdn.mos.cms.futurecdn.net/HC9xxjhtDxUXvq5YNW4ayW.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="the-gellars-friends-2-5">The Gellars - Friends 2/5</h2><p>Monica and Ross are typical sister-brother fodder. They both hang with all of their pals in a <a href="https://www.cinemablend.com/television/tv-homes-that-i-always-wanted-explore-live-in"><u>home I've wanted to explore</u></a> forever, and from time to time, break out an iconic childhood dance number. When their parents come into play, that rating dives off a cliff. While Ross is viewed as a golden child, Monica continuously gets scrutinized or patronized for every element of her life, and her bro is MIA to defend her.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="9BcHZTj7Rwo247Rz7qpwBN" name="41393667f8e9b52d658628e3ba29f8f5c37880fd.jpg" alt="Liz Sheridan, Barney Martin, Julia Louis-Dreyfus, and Jerry Seinfeld on Seinfeld" src="https://cdn.mos.cms.futurecdn.net/9BcHZTj7Rwo247Rz7qpwBN.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="the-costanzas-the-seinfelds-seinfeld-3-5">The Costanzas, The Seinfelds - Seinfeld 3/5</h2><p>While <em>Seinfeld</em> isn’t centered on regular relative relations, the Seinfelds and Costanzas got featured somewhat consistently. Jerry and his parents' (and occasionally, Uncle Leo's) dynamics are pretty run-of-the-mill, but can be somewhat quirky. Meanwhile, George’s mom and dad illustrate the louder side of caring, but also outspoken heads of the family. Together, they’re a hilarious blended group poking and prodding at their kids.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="HTnjHMB6rCKfX78LxviT9R" name="fresh-prince-of-bel-air-showrunner-1628084265981.jpeg" alt="Will Smith and his castmates in The Fresh Prince of Bel-Air." src="https://cdn.mos.cms.futurecdn.net/HTnjHMB6rCKfX78LxviT9R.jpeg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="the-banks-fresh-prince-of-bel-air-4-5">The Banks - Fresh Prince Of Bel-Air 4/5</h2><p>Like many of the other blended broods, the Banks show up at the end of the day for one another. Will coming to stay with the Bel-Air residents showcased from the jump what type of good-willed, community-driven people they are. Their actual reactions in their relationships on the surface may look quite different, though. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="KJMvyPCjmGCznXRdgzDDwP" name="marriedwithchildrenkateysegal.jpg" alt="Katey Sagal and Ed O'Neill on Married with Children" src="https://cdn.mos.cms.futurecdn.net/KJMvyPCjmGCznXRdgzDDwP.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="the-bundys-married-with-children-1-5">The Bundys - Married… With Children 1/5</h2><p>The <em>Married… with Children</em> family is built differently. The Bundys are filled with insults, bad luck, and relentless sarcasm, paired with Al’s bitterness, Peg’s laziness, and the kids’ scheming--making it one unpredictable place. As miserable as they claim to be in regards to money, love and success, they’re stuck together—and wouldn’t have it any other way.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="gs3gkaGhMxEjKGRU3D4rwN" name="modernfamily.jpg" alt="Modern Family." src="https://cdn.mos.cms.futurecdn.net/gs3gkaGhMxEjKGRU3D4rwN.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Peacock)</span></figcaption></figure><h2 id="the-tucker-pritchetts-pritchett-delgados-and-dunphys-modern-family-5-5">The Tucker-Pritchetts, Pritchett-Delgados and Dunphys - Modern Family 5/5</h2><p>Ed O’Neill’s second run with a family sitcom was as notable as <em>Married… With Children,</em> but related much better to his loved ones, playing Jay Pritchett, the staunch but understanding patriarch. Between him and his OG kids, Claire and Mitchell, their respective families, his new wife and kids, and everyone interacting regularly, it’s more often than not a fun-loving and humanistic give and take of blended familial relationships.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="vDPGsqpz2aexUpePxhSrFj" name="unnamed.jpg" alt="The Flintstones in their fly mobile" src="https://cdn.mos.cms.futurecdn.net/vDPGsqpz2aexUpePxhSrFj.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Hanna-Barbera Productions)</span></figcaption></figure><h2 id="the-flinstones-the-flintstones-3-5">The Flinstones - The Flintstones 3/5</h2><p>The titular family of the first notable animated sitcom premiered back in the 1960s. And while it was widely successful and has multiple iterations a la <em>The Addams Family</em>, Fred is far from Gomez. But the fictionalized caveman continued to show up for his family even when the going got tough, or got him flustered.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="DuufhAui5XdTLymtv4jtek" name="best animation bobs burgers .png" alt="bob, louise, tina, gene and linda belcher on the couch in bob's burgers" src="https://cdn.mos.cms.futurecdn.net/DuufhAui5XdTLymtv4jtek.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="the-belchers-bob-s-burgers-4-5">The Belchers - Bob’s Burgers 4/5</h2><p>As one of the <a href="https://www.cinemablend.com/television/most-rewatchable-tv-shows-ever"><u>most rewatchable shows ever</u></a>, The Belchers' family dynamic is the stuff of magic. While they may be far from perfect, overly successful, or even popular (to some), the five humorously and oddly show up for one another every week. Now and again, Bob or one of the other four shows some defiance with the goings on, but it never lasts for long.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="N7exeZ3iQBSPka4V8mPomB" name="Screen Shot 2022-09-23 at 10.40.21 AM.jpg" alt="full house pilot final scene" src="https://cdn.mos.cms.futurecdn.net/N7exeZ3iQBSPka4V8mPomB.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC/HBO Max)</span></figcaption></figure><h2 id="the-tanners-and-co-full-house-4-5">The Tanners (and co.) - Full House 4/5</h2><p>The blended household has a lot going on within all of its floors, including regularly showing up for each other. Danny, Joey, Becky and Jesse do their best for the collective kiddos but can also lead them into trouble from time to time. All in all, though, the collective fam has nothing but the best intentions, except maybe when DJ’s neighbor's best friend,  Kimmy Gibbler, comes around.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="QYbgPLe443hm3ZzBXNpvCD" name="bernie mac.jpg" alt="Bernie Mac in The Bernie Mac Show" src="https://cdn.mos.cms.futurecdn.net/QYbgPLe443hm3ZzBXNpvCD.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="the-mcculloughs-the-bernie-mac-show-4-5">The McCulloughs - The Bernie Mac Show 4/5</h2><p><em>The Bernie Mac Show</em> is another classic, somewhat reflective look into the late comedian Bernie Mac’s real life. As the McCulloughs take in their two nieces and nephew after their mom has issues, lots of boundaries are explored for the new fivesome. With his bold humor but well-intended grace, they all learn to bond. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="dQ6ebn2hZV8ynsPRLxQMZJ" name="Shamless TV Recommendations-3.jpg" alt="Frankie Muniz, Jane Kaczmarek, and Justin Tyler Berfield in Malcolm in the Middle" src="https://cdn.mos.cms.futurecdn.net/dQ6ebn2hZV8ynsPRLxQMZJ.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="the-wilkersons-malcolm-in-the-middle-3-5">The Wilkersons - Malcolm In The Middle 3/5</h2><p>Malcolm and the rest of his family live in middle-class chaos, outside of careers, much of which is due to the close-knit but quarrelsome four brothers. Regardless of how messy, wild, or outlandish it gets, Lois, with the help of Hal, is there to rein it all back in time and again. Through thick and thin, and a bonkers way of getting their feelings across, they continue to stick together.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="PURYKyiNCMHkfSizSwqdCN" name="raymondsuperbowl" alt="Ray Romano and Patricia Heaton sitting on a hotel bed on Everybody Loves Raymond" src="https://cdn.mos.cms.futurecdn.net/PURYKyiNCMHkfSizSwqdCN.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="the-barones-everybody-loves-raymond-4-5">The Barones - Everybody Loves Raymond 4/5</h2><p>Ray and his family live in a whirlwind of sarcasm, guilt trips, and unsolicited visits, mostly stirred up by their impossibly close but constantly bickering dynamic. With Marie’s meddling, Frank’s gruff indifference, and Robert’s simmering resentment, Ray and Debra are rarely left in peace. Still, no matter how overbearing or absurd it gets,  they always find a way to resolve any quip.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="RByU8t4JUx77QCu2yejhTT" name="Everybody Hates Chris Dinner" alt="The Rock family sitting around the dinner table, with Julius and Chris warily eyeing Rochelle as she pours herself a drink in Everybody Hates Chris." src="https://cdn.mos.cms.futurecdn.net/RByU8t4JUx77QCu2yejhTT.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Paramount+)</span></figcaption></figure><h2 id="the-rocks-everybody-hates-chris-4-5">The Rocks - Everybody Hates Chris 4/5</h2><p>The Chris Rock reflective sitcom is the perfect blend of comedy and heart between the core five. Even though the noted balance hangs true in most episodes, the reactions and happenings that fill out the original UPN show highlight the realities of their normalcy. All of them are trying their best in their personal and collective lives, and it’s an excellent showcase.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="8ezYTSorup4idXK67xpUTb" name="moesha.jpg" alt="Moesha (Brandy) and Dee (Sheryl Lee Ralph) on Moesha" src="https://cdn.mos.cms.futurecdn.net/8ezYTSorup4idXK67xpUTb.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: UPN)</span></figcaption></figure><h2 id="the-mitchells-moesha-3-5">The Mitchells - Moesha 3/5</h2><p>The Mitchells on <em>Moesha</em> broke barriers and still remains a part of pop culture due to breaking untrue industry perceptions. Though Frank ran his household in a tight manner, alongside his second wife, Dee (remarried after his first wife, Marguerite, passed), they faced issues head-on and together. (Including Frank’s past infidelities.)</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="ZoRLde9qvoaCmkeDxswhrC" name="georgelopezabcsitcom.jpg" alt="George Lopez on George Lopez" src="https://cdn.mos.cms.futurecdn.net/ZoRLde9qvoaCmkeDxswhrC.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="the-lopezes-george-lopez-4-5">The Lopezes - George Lopez 4/5</h2><p>Another outstanding example of parents and their kids comes from the early ‘00s <em>George Lopez</em> series. Not that it didn’t have its issues, including Lopez’s spotty communication skills, the fivesome navigated their best through an array of ups and downs using humor and diverse perspectives.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="aX2NdGRzDwjqA7BgMFKsXT" name="7-curb-trick-or-treat-larry-cops-id_b71fc6a1-5ff6-4561-8326-40a27758f03c.jpeg" alt="Larry and Cheryl with cops in Curb Your Enthusiasm" src="https://cdn.mos.cms.futurecdn.net/aX2NdGRzDwjqA7BgMFKsXT.jpeg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO)</span></figcaption></figure><h2 id="the-davids-curb-your-enthusiasm-1-5">The Davids - Curb Your Enthusiasm 1/5</h2><p>In the off chance you’re not familiar with this somewhat factual Larry David sitcom, Larry has and always will be the problem. It’s exactly why Cheryl Hines divorced him during the long-running 12-season show. The writer and comedian loosely based this on his own marriage, but with a larger-than-life comedic spin to it.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="TAoZt3DJKyJfpLiij89sgE" name="tedmosby.jpg" alt="Ted Mosby and Tracy cuddle under umbrella during Season 9 episode of HIMYM." src="https://cdn.mos.cms.futurecdn.net/TAoZt3DJKyJfpLiij89sgE.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="the-mosbys-how-i-met-your-mother-3-5">The Mosbys - How I Met Your Mother 3/5</h2><p>It may be a forgotten fact that the Mosby kids are sprinkled throughout the series, but their presence is the hinge of the show. From the small sampling we have of Ted with his son and daughter, it all seems pretty average (depending on who you ask). During the 9 seasons, Mosby ignores direct questions from his children, albeit comedically, and focuses on recounting the whole thing in order. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="n7yzokCEUA8724tgYy2MTZ" name="GOB banner.jpg" alt="The cast of Arrested Development on Season 3 Episode 3." src="https://cdn.mos.cms.futurecdn.net/n7yzokCEUA8724tgYy2MTZ.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="the-bluths-arrested-development-2-5">The Bluths - Arrested Development 2/5</h2><p>The Bluth family and their <a href="https://www.cinemablend.com/television/tv-shows-with-fake-businesses-everyone-knows"><u>fictional company</u></a> were a comedic trainwreck from start to finish. Even though they all had shining moments of showing up for each other, their rich, out-of-touch ways, personally and professionally, wreaked some major havoc. With the corrupt and scheming patriarch George Bluth at the helm, sooner or later, all the issues were bound to hit a boiling point.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="FSU7vPytZsb6uY9uEH3R7b" name="family guy.png" alt="the griffin family on family guy" src="https://cdn.mos.cms.futurecdn.net/FSU7vPytZsb6uY9uEH3R7b.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="the-griffins-family-guy-2-5">The Griffins - Family Guy 2/5</h2><p>As one of the more outlandish cartoon families, the Griffiths don’t hold down the homestead title as well as others. From Peter to Stewie, each of them has some highlights, but their flaws and how they relate to each other through those traits are the glue that somehow holds them together. Overall, they have fine moments of true connectedness, but it's not commonplace.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="oai5CFzRdj9UPjNTnH6kN6" name="tia tamera and ray.jpg" alt="Tia and Tamera Mowry with Tim Reid on Sister, Sister" src="https://cdn.mos.cms.futurecdn.net/oai5CFzRdj9UPjNTnH6kN6.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="the-landrys-campbells-sister-sister-5-5">The Landrys, Campbells - Sister Sister 5/5</h2><p>The <a href="https://www.cinemablend.com/television/sister-sister-things-i-still-love-about-the-classic-90s-sitcom"><u>still lovable </u><u><em>Sister Sister</em></u></a><em> </em>shows just how to work through a wildly unexpected happening together. Starring Tia and Tamera Mowry as long-lost twins of the same name to reunite and live with their respective parents under one roof takes a lot of gumption. By no means did the new era between the four run smoothly, but all were onboard to give it their best shot to let the sisters get to know each other.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="A46snNkRkpZQ3uu8jnWt8a" name="Schitt's Creek the cast walks on a dirt road looking absolutely horrified.jpg" alt="Catherine O'Hara, Eugene Levy, Annie Murphy, and Dan Levy walk on a dirt road looking absolutely horrified in Schitt's Creek" src="https://cdn.mos.cms.futurecdn.net/A46snNkRkpZQ3uu8jnWt8a.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBC/Pop Media Group)</span></figcaption></figure><h2 id="schitt-s-creek-5-5">Schitt’s Creek 5/5</h2><p>Co-creators and real-life father-son duo, Eugene and Dan Levy, nailed this fictional <a href="https://www.cinemablend.com/movies/riches-to-rags-stories-in-movies-and-tv-shows"><u>riches-to-rags story</u></a>’s foursome. The Canadian sitcom took over the world because of the Schitt’s humor, ridiculous banter, but a pure heart of gold for one another. From start to finish, we watched them grow as a family and as individuals who truly realized that our relationships are the most important thing any of us has.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="jZ5HBJsxtt6jy6WSHYvLSW" name="king of the hill cast.png" alt="the cast of king of the hill wearing nice clothes" src="https://cdn.mos.cms.futurecdn.net/jZ5HBJsxtt6jy6WSHYvLSW.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="the-hills-king-of-the-hill-4-5">The Hills - King Of The Hill 4/5</h2><p>You’d never expect a place like small-town Texas to house one of the <a href="https://www.cinemablend.com/television/the-75-best-animated-TV-shows-of-all-time"><u>best animated shows</u></a> and families of all time, but it does. The Hills reflect a completely average American family in suburbia, with, generally, semi-realistic issues they work through together. Hank may be a little rough around the edges when something goes wrong, but he usually works through it and celebrates by cracking open a cold one with his pals, uh-huh.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="HRiMD3u5mH2z3LiqjH2rnC" name="Fi-T-Top10-Its-Always-Sunny-In-Philadelphia-Moments-720p30.jpg" alt="The main cast of It's Always Sunny in Philadelphia." src="https://cdn.mos.cms.futurecdn.net/HRiMD3u5mH2z3LiqjH2rnC.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: FXX)</span></figcaption></figure><h2 id="the-reynolds-it-s-always-sunny-in-philadelphia-2-5">The Reynolds - It’s Always Sunny In Philadelphia 2/5</h2><p>The Philadelphia area-based family isn’t for the faint of heart. They are a ragtag bunch that dysfunctionally can be supportive, but often through very muddied lenses of narcissism, manipulative behavior or shallowness. Somehow, through all of the dynamics, they continue to co-own and <a href="https://www.cinemablend.com/television/32-great-tv-and-movie-bartenders"><u>successfully tend a bar</u></a> together.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="hJx6xjxUwP4JCCrhVJWjnc" name="3rd rock.jpg" alt="3rd Rock from the Sun cast" src="https://cdn.mos.cms.futurecdn.net/hJx6xjxUwP4JCCrhVJWjnc.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="the-solomons-3rd-rock-from-the-sun-3-5">The Solomons - 3rd Rock From The Sun 3/5</h2><p>This case stands a little differently from the rest, in terms of human family dynamics vs. alien ones. As the Solomons, the quartet of ETs are wacky and get into a lot of antics Earthside that get them into trouble. But how they act toward one another as who they really are helps bump their score up.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ 32 Relationships In Television That Defined Goals  ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/relationships-in-television-that-defined-goals</link>
                                                                            <description>
                            <![CDATA[ Okay, need my relationships to be exactly like these. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">ZEiZqYJDLXr2Yk637n83vi</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/DcmApKK3F4Fr4nFQRzwTzc-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Thu, 22 May 2025 19:33:00 +0000</pubDate>                                                                                                                                <updated>Thu, 19 Jun 2025 15:38:08 +0000</updated>
                                                                                                                                            <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Alexandra Ramos ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/4vCq2c3J9ZiZUXQ3hPz69T.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Alexandra Ramos is a Content Producer at CinemaBlend. She first started off working in December 2020 as a Freelance Writer after graduating from the Pennsylvania State University with a degree in Journalism and a minor in English. She later moved over to full-time in July of 2021, and primarily works in features for movies, TV, and sometimes video games. She is also the main person who runs both our daily newsletter, The CinemaBlend Daily, and our ReelBlend newsletter that is sent out bi-weekly to patrons.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;
&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Into&lt;/strong&gt;: Alex is into many things. She loves all kinds of movies except for super sappy romantic ones - with the only redeeming case being The Notebook, and is a big fantasy nerd. She’s a huge fan of the streaming shows that have been released, and loves to watch series’ like The Witcher, Shadow &amp;amp; Bone, and more. Her all-time favorite TV show has to be a solid three-way tie between Breaking Bad, Game of Thrones and Attack on Titan - she just can’t seem to pick one. Alex is also a big Marvel nerd, and will defend Scarlet Witch until her dying day. For years, she’s been an avid gamer, primarily for the PlayStation, and has become a part of the fanbase for games like The Last Of Us, God of War, Spider-Man, and more, but that won’t stop her from playing simple games like Animal Crossing, or FPS’ like Call of Duty. Alex is also a big sports fan and considers herself a couchside coach because she will threaten to throw stuff at her TV if Penn State or the NY Giants are losing (which is often), usually with pizza in her hands.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Excited About Right Now&lt;/strong&gt;: The Boys Season 4 and its spinoff, Gen V Season 2, House of the Dragon Season 2, The Bear Season 4, Fallout, and Bridgerton Season 3 because I&#039;m missing my steamy romance.&amp;nbsp;&lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/DcmApKK3F4Fr4nFQRzwTzc-1280-80.jpg">
                                                            <media:credit><![CDATA[Liam Daniel/Netflix]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Simone Ashley and Jonathan Bailey sit together as the look at something off screen in Bridgerton, S3 E5 - &quot;Tick Tock.&quot;]]></media:description>                                                            <media:text><![CDATA[Simone Ashley and Jonathan Bailey sit together as the look at something off screen in Bridgerton, S3 E5 - &quot;Tick Tock.&quot;]]></media:text>
                                <media:title type="plain"><![CDATA[Simone Ashley and Jonathan Bailey sit together as the look at something off screen in Bridgerton, S3 E5 - &quot;Tick Tock.&quot;]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/DcmApKK3F4Fr4nFQRzwTzc-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>You know when some good relationships on television make you want to squeal the moment you see them? Yeah, these are <em>the </em>relationships down below. Sure, we can spend some time watching the<a href="https://www.cinemablend.com/new/30-Best-Romantic-Comedies-All-Time-43134.html"><u> best rom-com movies</u></a>, but what about several seasons of build-up to a relationship that makes it all worthwhile? Here are some couples that define “goals.”</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="VUgowSdwZjja7FztpLnXpH" name="Monica and Chandler Relationship-14.jpg" alt="Monica and Chandler marry on Friends" src="https://cdn.mos.cms.futurecdn.net/VUgowSdwZjja7FztpLnXpH.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="chandler-and-monica-friends">Chandler And Monica (Friends)</h2><p>Chandler and Monica are <em>the </em>couple from the <a href="https://www.cinemablend.com/television/2474356/what-have-the-friends-cast-been-up-to-since-the-show-ended"><u><em>Friends </em></u><u>cast</u></a>, and I will not be asking any other questions about it at this time. Ross and Rachel were what people talked about, but these two? I love them. They are defined as “goals” based on how much they love each other, even if they didn’t have the typical start. Friends-to-lovers is one of the best.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="aNSGF2x5i7PQmdfoXHNi4k" name="shameless" alt="Ian and Mickey in Shameless." src="https://cdn.mos.cms.futurecdn.net/aNSGF2x5i7PQmdfoXHNi4k.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Starz)</span></figcaption></figure><h2 id="ian-and-mickey-shameless">Ian And Mickey (Shameless)</h2><p>There was a time when Ian and Mickey were literally <em>all </em>I saw on my Tumblr feed back in the early 2010s. The <a href="https://www.cinemablend.com/television/2565350/shameless-what-the-cast-is-doing-next"><u><em>Shameless </em></u><u>cast</u></a> featured plenty of great relationships, some healthy and others…not so healthy, but Ian and Mickey were a relationship that made it until the end. There’s nothing quite like them.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="EvgZsUGnLMTJQV2qFdMHrN" name="TIU finale main.jpg" alt="Jack and Rebecca on This Is Us." src="https://cdn.mos.cms.futurecdn.net/EvgZsUGnLMTJQV2qFdMHrN.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="rebecca-and-jack-this-is-us">Rebecca And Jack (This Is Us)</h2><p>The <a href="https://www.cinemablend.com/television/this-is-us-cast-where-youve-seen-the-actors-before"><u><em>This Is Us </em></u><u>cast</u></a> defined my time in college when the show was airing, and Jack and Rebecca were the blueprint for how I wanted my future marriage to go. I have never seen two people just <em>so </em>in love with each other on TV, but also portray such a realistic marriage. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="H9UhZbLJXtJuXjdKRp63HE" name="Boy Meets World Cory And Topanga Wedding.jpg" alt="Cory and Topanga getting married on Boy Meets World." src="https://cdn.mos.cms.futurecdn.net/H9UhZbLJXtJuXjdKRp63HE.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC/Disney+)</span></figcaption></figure><h2 id="corey-and-topanga-boy-meets-world">Corey And Topanga (Boy Meets World)</h2><p>I think Corey and Topanga were <em>the </em>couple for the '90s kids. I didn’t grow up watching <em>Boy Meets World, </em>but I know from <em>many </em>that watching these two grow into teenagers and then young adults was one of the best aspects of this series. And honestly, I love that for you. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="NJgy2iN9QUQNEydJaS2LHm" name="the office jim and pam" alt="Jim and Pam shocked after Deangelo Vickers' accident in The Office Season 7" src="https://cdn.mos.cms.futurecdn.net/NJgy2iN9QUQNEydJaS2LHm.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Peacock)</span></figcaption></figure><h2 id="jim-and-pam-the-office">Jim And Pam (The Office) </h2><p>Yes, yes, a thousand times yes. Sure, there were moments between Jim and Pam in later seasons that felt a little out of character, but these two were the <em>defining </em>relationship from <a href="https://www.cinemablend.com/television/2493700/what-the-office-cast-is-doing-now"><u><em>The Office </em></u><u>cast</u></a>. We were all on the edge of our seats at the beginning of the series when these two were just friends, and we wanted them all to get together. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="7f4tPGhz89YNa3BUtsyDhZ" name="6-parks-and-rec-ben-and-leslie-at-engagement-party" alt="Leslie Knope (Amy Poehler) and Ben Wyatt (Adam Scott) at engagement party in Parks and Recreation" src="https://cdn.mos.cms.futurecdn.net/7f4tPGhz89YNa3BUtsyDhZ.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC Universal)</span></figcaption></figure><h2 id="leslie-and-ben-parks-and-recreation">Leslie And Ben (Parks And Recreation)</h2><p>Leslie and Ben from the <a href="https://www.cinemablend.com/television/2495456/what-the-parks-and-recreation-cast-members-are-doing-now"><u><em>Parks and Recreation </em></u><u>cast</u></a> are the perfect example of a relationship that took its time but blossomed beautifully. Ben was the type of person who always let Leslie shine and never tried to dim her light, which is something that I love about them. They always supported each other no matter what. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="gRBCXCxbVygJ6Y3taBJtML" name="marshall and lily" alt="Marshall and Lily in How I Met Your Mother." src="https://cdn.mos.cms.futurecdn.net/gRBCXCxbVygJ6Y3taBJtML.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="marshall-and-lily-how-i-met-your-mother">Marshall And Lily (How I Met Your Mother)</h2><p>There have been <em>so </em>many relationships that have come and gone in <em>How I Met Your Mother, </em>but you want to know what one of the best was? Obviously, Marshall and Lily. I don’t think I’ve ever felt as many warm fuzzies as I did watching these two.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="vJwrKewcTQjpX7oq54pnJb" name="stefan and caroline" alt="Stefan and Caroline in The Vampire Diaries." src="https://cdn.mos.cms.futurecdn.net/vJwrKewcTQjpX7oq54pnJb.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: The CW)</span></figcaption></figure><h2 id="stefan-and-caroline-the-vampire-diaries">Stefan And Caroline (The Vampire Diaries)</h2><p>Team Stefan and Team Damon? Nah, Elena was always going to pick Damon and me, but Stefan and <em>Caroline? </em>Perfect, excellent. There are absolutely no notes on that couple because, honestly, they were better suited for each other. Sorry. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="AusSRoMPbkiXBqRudpz2Pg" name="schitt copy.jpg" alt="David and Patrick's wedding Schitt's Creek" src="https://cdn.mos.cms.futurecdn.net/AusSRoMPbkiXBqRudpz2Pg.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBC)</span></figcaption></figure><h2 id="david-and-patrick-schitt-s-creek">David And Patrick (Schitt’s Creek)</h2><p>I’m pretty sure watching David and Patrick in <em>Schitt’s Creek </em>altered my brain chemistry because I don’t think another TV couple has stood out the same as them. The <a href="https://www.cinemablend.com/television/2569420/schitts-creek-what-to-watch-if-youre-missing-the-cast-of-the-hilarious-comedy"><u><em>Schitt’s Creek </em></u><u>cast</u></a> is filled with memorable characters, but watching the progression of their relationship throughout its five seasons was something that I will always adore. These two loved each other <em>so </em>much. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="mG7LbQSUR4FS7PpXKrEttV" name="gilmore" alt="Lauren Graham and Scott Patterson as Lorelai and Luke in the snow in Season 1 of Gilmore Girls "Kiss And Tell"" src="https://cdn.mos.cms.futurecdn.net/mG7LbQSUR4FS7PpXKrEttV.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros. )</span></figcaption></figure><h2 id="luke-and-lorelai-gilmore-girls">Luke And Lorelai (Gilmore Girls)</h2><p>Look, I know that we’re all here for Team Jess or Team Dean or <em>whoever </em>we’re rooting for with Rory, but to me, as an adult woman now, I like Luke and Lorelai’s relationship a <em>heck </em>of a lot more. It feels more mature, more natural, and less dramatic. Please, give me this rather than the craziness of teenage romance. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="v7iaRFZUCLAkT473kCfbja" name="nathan and haley one tree hill.jpg" alt="Nathan with his arm around Haley who is smiling while holding her chin with one hand in One Tree Hill." src="https://cdn.mos.cms.futurecdn.net/v7iaRFZUCLAkT473kCfbja.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: The WB/The CW)</span></figcaption></figure><h2 id="nathan-and-haley-one-tree-hill">Nathan And Haley (One Tree Hill)</h2><p>The <em>definition </em>of high school sweethearts that somehow worked out. They definitely had their moments of doubt throughout the <em>nine </em>seasons of the show, but these two loved each other so much and ended with a happily married life with two children, which is all you can really ask for in most teen drama romances out there. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="F2U826oi8Nuo7akEqH4ZU3" name="fresh prince of bel air" alt="Phil and Vivian in The Fresh Prince of Bel-Air." src="https://cdn.mos.cms.futurecdn.net/F2U826oi8Nuo7akEqH4ZU3.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="phil-and-vivian-the-fresh-prince-of-bel-air">Phil And Vivian (The Fresh Prince Of Bel-Air)</h2><p>I’m sure you weren’t expecting to see Phil and Vivian on this list because <em>The Fresh Prince of Bel-Air </em>isn’t really known for its romances. But honestly, Phil and Vivian <em>are </em>the perfect couple. They complement each other perfectly, know when to be each other’s rock or to stop the other from making a poor decision, and took care of Will as well as their biological family in the perfect way. I have no complaints. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="hwfiqWu8nmKjmdJ5XGEdFJ" name="santana and britney.jpg" alt="Santana leaning her head on Britney's shoulder in Glee." src="https://cdn.mos.cms.futurecdn.net/hwfiqWu8nmKjmdJ5XGEdFJ.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="santana-and-brittany-glee">Santana And Brittany (Glee)</h2><p>The <a href="https://www.cinemablend.com/television/2560631/what-the-glee-cast-is-doing-now"><u><em>Glee </em></u><u>cast</u></a> is filled to the brim with couples, so much so that it’s hard to keep up with them. But my personal favorite was always Santana and Brittany. Not only was their relationship a <em>great </em>stepping stone for many lesbian/bisexual relationships on TV back in 2010, but it’s really one of the few that made it to the very end of the series. They were best friends turned lovers turned to something <em>really </em>real, and it ended with them getting married!</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="bMmKXrvvb5Xv4oHGD8Cd4V" name="Randall and Beth.jpg" alt="Randall and Beth Pearson on This Is Us." src="https://cdn.mos.cms.futurecdn.net/bMmKXrvvb5Xv4oHGD8Cd4V.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="randall-and-beth-this-is-us">Randall And Beth (This Is Us)</h2><p>“Perfectly imperfect” is a phrase that I still use to this day, ever since Randall uttered it to Beth in <em>This Is Us. </em>These two exemplify what it means to not only marry your best friend, but also marry a <em>partner. </em>They will stand by each other, support each other, and when someone is messing up, they will make them own up to it. There’s no sliding, and that’s what a genuine relationship should be like.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="WFJa3fzxg8iNU76vtj6Dna" name="header.jpg" alt="Zooey Deschanel and Jake Johnson as Jess and Nick on New Girl" src="https://cdn.mos.cms.futurecdn.net/WFJa3fzxg8iNU76vtj6Dna.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="jess-and-nick-new-girl">Jess And Nick (New Girl)</h2><p><em>New Girl </em>is one of those shows where relationships come and go, but there are always a few that stick the landing for the long haul. Jess and Nick were one of those, and we rooted for them, watching them fall in love, fall apart, and then fall back in love all over again.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="yAPuY4uAkUMfqr2RKK77RH" name="Jesse and Rebecca_Full House.jpg" alt="Uncle Jesse and Aunt Becky (John Stamos and Lori Loughlin) on Full House" src="https://cdn.mos.cms.futurecdn.net/yAPuY4uAkUMfqr2RKK77RH.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="uncle-jesse-and-aunt-becky-full-house">Uncle Jesse And Aunt Becky (Full House)</h2><p>I mean, <em>of course, </em>I have to put Uncle Jesse and Aunt Becky. I feel like <em>Full House </em>literally never would have been the same without them. Their relationship started very early on, and it’s always fun to rewatch episodes of the show and watch them fall in love with each other time and time again. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="V4W7YYNHsY9HX4kfQTn5r7" name="Kate’s Final Pall Mall Dress From Season 2, Episode 8" alt="Anthony and Kate smiling, walking and holding hands with Anthony's hand draped over Kate's shoulder." src="https://cdn.mos.cms.futurecdn.net/V4W7YYNHsY9HX4kfQTn5r7.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Cr. Liam Daniel/Netflix)</span></figcaption></figure><h2 id="anthony-and-kate-bridgerton">Anthony And Kate (Bridgerton)</h2><p>While I do love the <a href="https://www.cinemablend.com/interviews/full-story-behind-how-bridgerton-season-3-adapted-penelope-and-colin-love-story"><u>specialness of Penelope and Colin</u></a> and the steaminess of Daphne and Simon, there’s just something about Anthony and Kate that gets me going every time. These two, a classic enemies-to-lovers romance, clearly love each other <em>so much </em>by the time the season ends and Season 3 rolls around. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="PMRm25uJYcTzJoR67sLRJK" name="imageedit_140_2935177462.jpg" alt="Outlander Season 7, Jamie and Claire" src="https://cdn.mos.cms.futurecdn.net/PMRm25uJYcTzJoR67sLRJK.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Starz)</span></figcaption></figure><h2 id="claire-and-jamie-outlander">Claire And Jamie (Outlander) </h2><p><em>Outlander, </em>in general, is one of <a href="https://www.cinemablend.com/television/2551544/outlander-and-other-great-shows-to-stream-on-starz"><u>the best Starz shows</u></a>, but a big reason is Claire and Jamie. Their love has transcended literal <em>timelines. </em>I don’t know how you can get more perfect than that. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="m2sFX8RVMr2TqRiNGn8kbK" name="Modern Family.jpg" alt="Jesse Tyler Ferguson and Eric Stonestreet on Modern Family" src="https://cdn.mos.cms.futurecdn.net/m2sFX8RVMr2TqRiNGn8kbK.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="mitch-and-cam-modern-family">Mitch And Cam (Modern Family)</h2><p>I think when it comes to couples in <em>Modern Family, </em>Mitch and Cam are the perfect example of how two people work so well together, and to the outside, people wonder how the heck they function with how crazy they are. But throughout the several seasons of the show, there’s no denying that these two love each other dearly. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="hcwAXSUCGbZ7CvHcm5XbM6" name="controversylucy" alt="Lucille Ball and Desi Arnaz at Ricky's show on I Love Lucy" src="https://cdn.mos.cms.futurecdn.net/hcwAXSUCGbZ7CvHcm5XbM6.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="lucy-and-ricky-i-love-lucy">Lucy And Ricky (I Love Lucy)</h2><p>I can’t have a relationships list without putting the OG’s here. Lucy and Ricky are the definition of “goals.” They were the first people on television to show you how in love with each other they are, no matter the amount of shenanigans that they may put the other through. You can’t get better than these two. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="FrJ2f2H5i4v8UMqYpP94tC" name="modern family" alt="Claire and Phil in Modern Family." src="https://cdn.mos.cms.futurecdn.net/FrJ2f2H5i4v8UMqYpP94tC.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="phil-and-claire-modern-family">Phil And Claire (Modern Family)</h2><p>I always see Phil and Claire as the much calmer couple of <em>Modern Family, </em>which is saying something because they still have their fair share of hilarious moments in their household of three kids. But what I love about Phil and Claire is that there is evident respect there, and Phil will support Claire no matter what and stand up for her, while Claire will do the same, regardless of what others think. They’re a team, through and through. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="k7FMn4cwzq49bASvMLaQFi" name="Once Upon a Time, Hook and Emma..jpg" alt="Emma and Hook in Once Upon a Time." src="https://cdn.mos.cms.futurecdn.net/k7FMn4cwzq49bASvMLaQFi.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="killian-and-emma-once-upon-a-time">Killian And Emma (Once Upon A Time)</h2><p>God, there are <em>so many </em>couples in <em>Once Upon a Time, </em>but I think the one we always return to is Killian and Emma. Whether it’s their steamy chemistry or their genuinely emotional story, they are an amazing romance with plenty of fantasy aspects that I just love. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="L8ixHssGitNADoERX9xkvW" name="willow andtara" alt="Willow and Tara in Buffy the Vampire Slayer." src="https://cdn.mos.cms.futurecdn.net/L8ixHssGitNADoERX9xkvW.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: The WB)</span></figcaption></figure><h2 id="willow-and-tara-buffy-the-vampire-slayer">Willow And Tara (Buffy The Vampire Slayer)</h2><p>As someone who <em>loves </em>looking back on legendary relationships that paved the way for others, I know there’s no one better to bring up than Willow and Tara. The couple was a significant landmark for LGBTQ+ representation in television and showed two people who clearly loved each other. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="P9wqFMKYLPAy3YntiPmPah" name="kev and veronica" alt="Kev and Veronica in Shameless." src="https://cdn.mos.cms.futurecdn.net/P9wqFMKYLPAy3YntiPmPah.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Starz)</span></figcaption></figure><h2 id="kev-and-veronica-shameless">Kev And Veronica (Shameless)</h2><p>These two were freaky, don’t get me wrong – but they were also freakishly in love with each other. Kev and Veronica <em>stood </em>by each other, and when someone dared to threaten the other, it was <em>on sight. </em>They would fight anyone to protect their love and their relationship, and no matter what, always strived to make time for the other. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="rNxSB6PYLzbxmCwtPEi8LV" name="Cyh6_GaXAAs-G7g.jpg" alt="Charles Shaughnessy and Fran Drescher in The Nanny" src="https://cdn.mos.cms.futurecdn.net/rNxSB6PYLzbxmCwtPEi8LV.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="fran-and-mr-sheffield-the-nanny">Fran And Mr. Sheffield (The Nanny)</h2><p>I’m pretty sure that if you’ve ever read <em>any </em>rom-com novel, then these two are who you picture when you think of the nanny and the billionaire falling in love. But what I love about Fran and Mr. Sheffield is that it’s not an instant lust between them. It’s more of a relationship built on respect and friendship before love was even considered. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="zENyNKPAeYjDH2pDu2mL77" name="brooklyn nine nine" alt="Jake and Amy in Brooklyn Nine-Nine." src="https://cdn.mos.cms.futurecdn.net/zENyNKPAeYjDH2pDu2mL77.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="jake-and-amy-brooklyn-nine-nine">Jake And Amy (Brooklyn Nine-Nine)</h2><p>The <a href="https://www.cinemablend.com/television/brooklyn-nine-nine-what-the-cast-of-the-iconic-comedy-is-doing-next"><u><em>Brooklyn Nine-Nine </em></u><u>cast</u></a> features some hilarious characters, but personally, I always came back for Jake and Amy. I always saw them as rivals-to-lovers, but it feels so real watching them turn from competing with each other to becoming friends to going on dates and so much more. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="rsrYtY2XyAJuDuyMXFXCvS" name="jane the virgin crop.jpg" alt="Jane and Rafael laying on the couch together in Jane the Virgin." src="https://cdn.mos.cms.futurecdn.net/rsrYtY2XyAJuDuyMXFXCvS.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: The CW)</span></figcaption></figure><h2 id="jane-and-rafael-jane-the-virgin">Jane And Rafael (Jane The Virgin)</h2><p>These two are in a <em>strange </em>situation, considering they didn’t even <em>know </em>each other when Jane fell pregnant accidentally. But watching their relationship grow organically throughout the show’s seasons is always something that I love to view.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="VK9x5UqZe8h2w7mr6MA9eD" name="TWD_905_JLD_0619_02981_RT.0 (1).jpg" alt="Andrew Lincoln and Danai Gurira in The Walking Dead" src="https://cdn.mos.cms.futurecdn.net/VK9x5UqZe8h2w7mr6MA9eD.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: AMC)</span></figcaption></figure><h2 id="rick-and-michonne-the-walking-dead">Rick And Michonne (The Walking Dead)</h2><p>When you think of couples who would <em>literally </em>kill for each other, I can think of no better than Rick and Michonne<em>. </em>Not only are they one of the <a href="https://www.cinemablend.com/television/2561702/the-walking-deads-best-character-couples-ranked"><u>best </u><u><em>Walking Dead </em></u><u>relationships</u></a>, but there was a whole spinoff series dedicated to them finding their way back to each other after years apart. Now <em>that </em>is true love right there. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="6JFeoVj3vN99wTh95zuvkL" name="orange is the new black" alt="Soso and Poussey in Orange is the New Black." src="https://cdn.mos.cms.futurecdn.net/6JFeoVj3vN99wTh95zuvkL.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="poussey-and-soso-orange-is-the-new-black">Poussey And Soso (Orange Is the New Black)</h2><p>It hurts to even write about Poussey and Soso because it feels like they weren’t given enough time together in <em>Orange is the New Black, </em>but from what we were able to see, they really did work well together. Poussey was the kind of friend that Soso needed, and that blossomed into something brighter between the two of them before it was snuffed out. I needed so much more. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="EexeMhZw2EicRBMksgRRaR" name="The Addams Family Streaming-2.jpg" alt="John Astin and Carolyn Jones in The Addams Family" src="https://cdn.mos.cms.futurecdn.net/EexeMhZw2EicRBMksgRRaR.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: MGM Television)</span></figcaption></figure><h2 id="morticia-and-gomez-the-addams-family">Morticia And Gomez (The Addams Family)</h2><p>I mean, talk about a man who is <em>obsessed </em>with his woman. In any iteration of <em>The Addams Family, </em>Gomez always loves Morticia, but of course, we have to put the OG here from the 1960s TV series because these two were so in love that they ruined our expectations for all real-life romances. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="rcndUyHJSKGjJ9WCHBQ5iF" name="glenn-and-maggie-reunite (1).jpg" alt="Maggie and Glenn reuniting on The Walking Dead." src="https://cdn.mos.cms.futurecdn.net/rcndUyHJSKGjJ9WCHBQ5iF.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: AMC)</span></figcaption></figure><h2 id="glenn-and-maggie-the-walking-dead">Glenn And Maggie (The Walking Dead) </h2><p>Yeah, I’m sad even writing about these two because the way it ends is something I don’t like to think about. But for the five seasons that we got with these two together, they were a light in the darkness that <em>was </em>the world of <em>The Walking Dead. </em>They loved each other, protected each other, and stood by the other until the very end. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="H4mcjHjhXD6fqjaxbXVFeY" name="joyce hopper russia.png" alt="joyce hugs hopper in the russian prison in stranger things season 4" src="https://cdn.mos.cms.futurecdn.net/H4mcjHjhXD6fqjaxbXVFeY.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="hopper-and-joyce-stranger-things">Hopper And Joyce (Stranger Things)</h2><p>God, I visibly remember screaming when these two finally got together in <em>Stranger Things </em>because it was just <em>so apparent </em>that they were into each other. Hopper literally risked his life for Joyce, and she risked hers to save him, and I <em>love them together. </em></p><p>This just makes me want to revisit all of these television shows and watch these couples all over again. I’m in need of some cute TV romances. It's time for a binge-watch. </p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ Full House’s Jodie Sweetin And Andrea Barber Weighed In On Doing Another Spinoff, And They Made A Good Point About The ‘Challenge’ Of Making It ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/full-houses-jodie-sweetin-andrea-barber-weighed-in-another-spinoff-challenge-making-it</link>
                                                                            <description>
                            <![CDATA[ It's not as easy as you'd think. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">Ay9Xg7GrY6w5hs5a26Awhj</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/PoyqCrUzky7kZqWSHgWSRD-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Mon, 19 May 2025 23:20:29 +0000</pubDate>                                                                                                                                <updated>Tue, 20 May 2025 07:12:37 +0000</updated>
                                                                                                                                            <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Megan Behnke ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/FBUR6A5F9FTHQpVfjSuYpL.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Megan Behnke has been a Freelance TV News Writer at CinemaBlend since 2021. She has worked at multiple entertainment outlets, including as a Writer and Editor at Nerds and Beyond, TV and Movie News Writer at CBR, and a Freelance Writer at TV Fanatic, writing about topics she&#039;s passionate about like pop culture. She graduated from the University of Wisconsin Oshkosh with a degree in Multimedia Journalism in 2020, writing for the school’s newspaper during her time there. Her expertise in entertainment is mainly in television, but she has written about movies, music, and local events as well.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What They&#039;re Into&lt;/strong&gt;: Megan specializes in television writing, particularly procedurals. 9-1-1 and the Chicago Franchise are currently her favorites, where she can be found obsessively watching the latest episode or coming up with theories. She also loves to listen to music, with Taylor Swift being on the top of her playlist. She isn’t a huge sports person but will occasionally root for the Green Bay Packers, Milwaukee Brewers, and Wisconsin Badgers. As for movies, it’s hard to pick a favorite, but the Marvel Cinematic Universe reigns as her favorite franchise. She used to be a book nerd in grade school, with her favorite genre being fantasy or YA. Her favorite snack is sour cream and onion Pringles, while pizza is her all-time favorite food.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What They&#039;re Excited About Right Now&lt;/strong&gt;: Manifest Season 4 finally coming to Netflix, One Chicago, and Taylor Swift’s upcoming Midnights album, which will be on repeat.&lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/PoyqCrUzky7kZqWSHgWSRD-1280-80.jpg">
                                                            <media:credit><![CDATA[Max]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Andrea Barber and Jodie Sweetin looking upset on Full House.]]></media:description>                                                            <media:text><![CDATA[Andrea Barber and Jodie Sweetin looking upset on Full House.]]></media:text>
                                <media:title type="plain"><![CDATA[Andrea Barber and Jodie Sweetin looking upset on Full House.]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/PoyqCrUzky7kZqWSHgWSRD-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p><em>Full House </em>premiered on ABC back in 1987, and to this day, the show remains a favorite among many and is arguably one of the <a href="https://www.cinemablend.com/television/100-best-tv-sitcoms-of-all-time-ranked">best sitcoms of all time</a>. Whether with reruns, streaming it with a <a href="https://www.cinemablend.com/television/2570432/subscribing-to-hbo-max-what-to-know-about-the-price-options-and-what-the-streaming-service-offers">Max subscription</a>, or watching the Netflix revival, the Tanner family will forever be one of television’s best families. As for whether another <em>Full House </em>series could ever happen in the future, Jodie Sweetin and Andrea Barber weighed in on the possibility, and they make some good points.</p><p><em>Full House </em>ran for eight seasons, ending in 1995, and then the extended family came back in <em>Fuller House </em>on Netflix for five seasons, from 2016 to 2020. Although <em>Full House</em> <a href="https://www.cinemablend.com/television/tv-shows-that-really-did-not-need-reboots">didn't need a reboot</a>, that didn't stop Netflix from doing one. There have been some talks about doing another show in the distant future, with Stephanie actress Sweetin even suggesting a <em>Golden Girls</em>-esque spinoff. </p><p>She and Barber, who played Kimmy, spoke about doing another show on their podcast, <a href="https://open.spotify.com/episode/4rzggfddHZeU8IHU2gMeGe"><em>How Rude, Tanneritos!</em></a> by answering a question from a fan wondering how serious their talks about a <em>Fullest House </em>are, and Barber had a simple three-word answer:</p><div><blockquote><p>Never say never. </p></blockquote></div><p>Sweetin agreed with her co-host’s answer, but also elaborated more on it, noting that it’s a bit too soon to do another show, and I can’t say I disagree. <em>Fuller House </em>only ended five years ago, and the series came out over 20 years after <em>Full House </em>ended. But that doesn’t mean that Sweetin hasn’t thought about the perfect way to do another series, because she has, and she is sticking to <a href="https://www.cinemablend.com/television/jodie-sweetin-has-idea-full-house-cast-should-do-another-series-i-dont-hate-it">her <em>Golden Girls </em>idea</a>:</p><div><blockquote><p>We need some more time. It’s too soon. But I absolutely would do it. Again, if we could come back and like, finally, I feel like do that ridiculous sort of adult sitcom because then we would be –  you know, give us another 15 years or whatever. The kids that were watching Fuller House will now be the age, like, in their 20s with their own [kids]. So I feel like all the generations would have moved up enough that you could do kind of a bawdy, Golden Girls-esque silliness of the three.</p></blockquote></div><p>Barber went on to explain that there’s a challenge to doing another spinoff of <em>Full House</em> so soon, and it certainly makes sense. Although it would be fun to follow a similar format that <em>Full House </em>and <em>Fuller House </em>did, there’s only so much that can be done and so many characters that fans will actually want to follow. Hence, the <em>Golden Girls </em>idea:</p><div><blockquote><p>Well, that’s the challenge is because if we follow the format, Fullest House would focus on our kids. But I think the audience, like the OG Full House audience, they're invested in the OG characters. </p></blockquote></div><p>Obviously, the kids in <em>Fuller House </em>were interesting, and it was fun to see DJ and Kimmy as moms and Stephanie as an aunt (later a mother), but the reason why <em>Fuller House </em>did so well and came to be in the first place was because it centered on the original characters that people grew up with. </p><p>That’s not to say longtime Tanner fans don’t care about the kids in <em>Fuller House</em>, but they would certainly be interested in the original characters. And Sweetin knows what kind of place would be perfect to revisit them in:</p><div><blockquote><p>Yeah, they would want to see us in the retirement home.</p></blockquote></div><p>Sweetin continued to say that she sees the characters in their late 60s, and they come back and are very much still who they have always been. Barber added that Stephanie, Kimmy, and DJ are all living together in the same retirement community. Honestly, I would love it. Of course, <a href="https://www.cinemablend.com/television/john-stamos-gets-honest-about-whether-hed-do-another-full-house-spinoff-without-bob-saget">anything new with <em>Full House </em>would be hard without Bob Saget</a>, who <a href="https://www.cinemablend.com/television/full-house-star-bob-saget-is-dead-at-65">died in 2022</a>, but a <em>Fullest House </em>set in a retirement community sounds perfect.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ One Ridiculously Unrealistic Thing About 32 '90s TV Shows ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/ridiculously-unrealistic-things-about-90s-tv-shows</link>
                                                                            <description>
                            <![CDATA[ So, about Tim "The Toolman" Taylor... ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">kfc5A2vTosQZ8GSqJDkPFg</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/H7toofq5fL8DDrqzicKXH-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Thu, 15 May 2025 20:31:10 +0000</pubDate>                                                                                                                                <updated>Thu, 19 Jun 2025 15:38:53 +0000</updated>
                                                                                                                                            <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Philip Sledge ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/EkAcyCb4XhyxmBbguSQhEX.jpg ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Philip Sledge is a content writer at CinemaBlend with a focus on longform features. He started writing for the website in December 2019, though his journey in journalism started years earlier. Writing gigs with school newspapers, multiple daily newspapers, and other varied job experiences led him to this point where he actually gets to write about movies, shows, wrestling, and documentaries (which is a huge win in his eyes).&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Into&lt;/strong&gt;: As has been in the case for many years, Philip loves all things professional wrestling (especially early &#039;90s WCW and late-stage WCW if we&#039;re being honest). But outside of the squared circle, Philip is obsessed with all things George A. Romero as you can probably tell by the plethora of zombie stories he&#039;s written over the years. Documentaries, especially Frontline specials, are another passion for Philip, and he can often be heard going on and on about why everyone should watch some random doc about an obscure movie no one has ever seen before.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Excited About Right Now&lt;/strong&gt;: Oppenheimer... so much so that his wife has asked him multiple times to stop talking about it (but he keeps doing it). He&#039;s also into Peacock&#039;s Twisted Metal series, which has rekindled his love of the classic vehicular combat video game. And since we&#039;re being all nostaglic, he&#039;s pumped to see Teenage Mutant Ninja Turtles: Mutant Mayhem.&lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/H7toofq5fL8DDrqzicKXH-1280-80.jpg">
                                                            <media:credit><![CDATA[Disney+]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Tim Taylor smiling inside house in Home Improvement]]></media:description>                                                            <media:text><![CDATA[Tim Taylor smiling inside house in Home Improvement]]></media:text>
                                <media:title type="plain"><![CDATA[Tim Taylor smiling inside house in Home Improvement]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/H7toofq5fL8DDrqzicKXH-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>The 1990s gave us <a href="https://www.cinemablend.com/television/100-best-tv-sitcoms-of-all-time-ranked"><u>all-time great sitcoms</u></a> like <em>Home Improvement</em> and <em>Friends</em>, iconic crime dramas like <em>Law & Order</em> and <em>Oz</em>, and so many other legendary shows considered “must-see TV” by millions of people week in and week out. And while those shows gave us unforgettable characters, side-splitting and shocking moments, and jokes that are still being told decades later, they also had some outrageously nonsensical or head-scratching moments.</p><p>That said, here’s one ridiculously unrealistic thing about 32 ‘90s TV shows…</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="5446zEfveX8Ebpxktpn94R" name="Painted Ladies Full House.jpg" alt="A shot of the cast of Full House in a park in front of the Painted Ladies in San Francisco" src="https://cdn.mos.cms.futurecdn.net/5446zEfveX8Ebpxktpn94R.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="there-s-no-way-danny-tanner-could-afford-that-house-full-house">There's No Way Danny Tanner Could Afford That House (Full House)</h2><p>There’s so much ridiculousness going on with <em>Full House</em>, but one question that remains just as baffling now as it did decades ago is “How did Danny Tanner afford a historic house in the heart of San Francisco?” The math just doesn’t work when you have a local news anchor and a pair of part-time jingle writers paying the mortgage and other expenses for an ever-growing household.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="CTiEGtRs6XpT8qtrVjrpHn" name="feeny.jpg" alt="Mr. Feeny sitting behind desk in school court on Boy Meets World" src="https://cdn.mos.cms.futurecdn.net/CTiEGtRs6XpT8qtrVjrpHn.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney+)</span></figcaption></figure><h2 id="mr-feeny-teaches-the-main-characters-through-multiple-grades-and-several-schools-boy-meets-world">Mr. Feeny Teaches The Main Characters Through Multiple Grades And Several Schools (Boy Meets World)</h2><p>There’s nothing wrong with Mr. Feeny on <em>Boy Meets World</em>; in fact, William Daniels’ take on the beloved teacher and neighbor was one of the show’s greatest strengths. However, this educator stays with Corey Matthews and his friends through middle school, high school, and college. The guy was either teaching above his level or dumbing it down early in his career to spend more time with those kiddos.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Uz89bAGyyn8dJEkiD3ckYL" name="Family Matters Stefan" alt="Jaleel White on Family Matters" src="https://cdn.mos.cms.futurecdn.net/Uz89bAGyyn8dJEkiD3ckYL.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="steve-urkel-cloned-himself-family-matters">Steve Urkel Cloned Himself (Family Matters)</h2><p>Let’s face it, <a href="https://www.cinemablend.com/television/times-family-matters-steve-urkel-jaleel-white-made-complete-mess"><u>Steve Urkel was a mess</u></a> on <em>Family Matters</em>. This guy built outrageous machines, destroyed the Winslow house countless times, and went to space, but the most unrealistic thing he ever did was clone himself. Not only does human cloning not exist, but his clone, Stefan Urquelle, was just too cool (and not in a good way).</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="75zXyEkDytpKhC7oRkcnQ7" name="Home Improvement Tim Allen Rich Karn.jpg" alt="Tim Allen and Richard Karn in Home Improvement." src="https://cdn.mos.cms.futurecdn.net/75zXyEkDytpKhC7oRkcnQ7.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Hulu/ABC)</span></figcaption></figure><h2 id="there-s-no-way-tim-taylor-could-survive-all-those-tool-time-mishaps-home-improvement">There's No Way Tim Taylor Could Survive All Those 'Tool Time' Mishaps (Home Improvement)</h2><p>You’ve heard of cats having nine lives, but what about TV show hosts from Detroit? How many do they have? Well, Tim “The Toolman” Taylor must have had at least 50 on <em>Home Improvement</em> because he survived being crushed, electrocuted, burnt, you name it.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="QdpHKHwuEokP5MTKiUQZ6J" name="darkgary" alt="Ross Hull as Gary sitting in front of the fire with the Midnight Society on Are You Afraid of the Dark?" src="https://cdn.mos.cms.futurecdn.net/QdpHKHwuEokP5MTKiUQZ6J.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Nickelodeon)</span></figcaption></figure><h2 id="the-midnight-society-a-group-of-kids-is-able-to-meet-in-the-middle-of-the-night-are-you-afraid-of-the-dark">The Midnight Society (A Group Of Kids) Is Able To Meet In The Middle Of The Night (Are You Afraid Of The Dark?)</h2><p>The <a href="https://www.cinemablend.com/television/best-episodes-from-great-anthology-tv-shows"><u>various stories told during </u><u><em>Are You Afraid of the Dark?</em></u></a> were intense and fantastical and terrifying at times, but that’s not the unrealistic part. Instead, what’s up with “The Midnight Society,” the group of kids and teenagers who would sneak out of their houses in the middle of the night to tell scary stories in the woods? Where are the parents?</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="VsBdBPhXw4C5VTeH7LMeoY" name="Screen Shot 2025-04-05 at 1.42.22 PM" alt="The cast of Friends during the finale" src="https://cdn.mos.cms.futurecdn.net/VsBdBPhXw4C5VTeH7LMeoY.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros. )</span></figcaption></figure><h2 id="monica-s-apartment-friends">Monica's Apartment (Friends)</h2><p>Sure, it is later revealed there was a loophole that allowed Monica to have a cheap apartment in Manhattan throughout <em>Friends</em>, but this whole rent-control aspect is so unrealistic.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="byHYF6gsWaTeEAUmtQtWe6" name="x-files.jpg" alt="David Duchovny and GIllian Anderson on The X-Files" src="https://cdn.mos.cms.futurecdn.net/byHYF6gsWaTeEAUmtQtWe6.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="that-time-scully-had-an-alien-baby-the-x-files">That Time Scully Had An Alien Baby (The X-Files)</h2><p><em>The X-Files</em> was one wild show where anything and everything could happen. But what about when Scully got pregnant with the help of aliens? Yeah, this is a show that doesn’t live within the constraints of reality, but this is a stretch.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Vm5q7FjcBB6ffUurf2mvDa" name="i9b7virs-1920.jpg" alt="Kurtwood Smith on That '70s Show" src="https://cdn.mos.cms.futurecdn.net/Vm5q7FjcBB6ffUurf2mvDa.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="the-gang-s-extracurricular-activities-go-unnoticed-by-red-forman-that-70s-show">The Gang's Extracurricular Activities Go Unnoticed By Red Forman (That '70s Show)</h2><p>Red Forman is a no-nonsense and tough-as-nails father who doesn’t seem like a guy who would like to be tricked, lied to, or misled… especially in his own home. Are you honestly saying he didn’t know what Eric and his friends were up to down in the basement? Really?</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="rt5KVjxjfRvRPtSijUDNnE" name="L&O main.png" alt="Sam Waterston stars as Jack McCoy on Law & Order." src="https://cdn.mos.cms.futurecdn.net/rt5KVjxjfRvRPtSijUDNnE.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="jack-mccoy-s-success-rate-law-order">Jack McCoy's Success Rate (Law & Order)</h2><p><em>Law & Order </em>is one of the great crime/legal dramas in the history of TV, but the one thing that’s always been baffling (especially during the show’s glory days) is Jack McCoy’s success rate in the courtroom. This guy is constantly collecting wins in high-profile cases, so much so that it seems too good to be true.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="z3GHJyddzZNbAnCgni7fjH" name="ER Anthony Edwards.jpg" alt="Anthony Edwards on ER" src="https://cdn.mos.cms.futurecdn.net/z3GHJyddzZNbAnCgni7fjH.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="the-er-doctors-are-jacks-of-all-trades-er">The ER Doctors Are Jacks Of All Trades (ER)</h2><p><em>ER</em> will forever be remembered as one of the most popular medical dramas to ever grace the small screen, but that doesn’t mean it didn’t have its problems. The biggest of those has to be the fact that some of the doctors were jacks of all trades. Sure, they are in the emergency room at a trauma center, but they were all like five doctors in one at various points throughout the series. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="TtSK32eKEadWhjsyPw5oi4" name="Dawson's Creek Pilot Thoughts-1.jpg" alt="James Van Der Beek and Katie Holmes in Dawson's Creek" src="https://cdn.mos.cms.futurecdn.net/TtSK32eKEadWhjsyPw5oi4.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: The WB)</span></figcaption></figure><h2 id="the-way-the-teenagers-talk-about-politics-cinema-and-poetry-dawson-s-creek">The Way The Teenagers Talk About Politics, Cinema, And Poetry (Dawson's Creek)</h2><p>Have you gone back and watched <em>Dawson’s Creek</em>? What’s up with the cast of teenagers shooting out dialogue that sounds like it was an AI-generated version of a first-year English major’s diary? They talk about politics, cinema, poetry, and music like they’re adults, not sappy teenagers living in a fictional Massachusetts town.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="hQDzd9aiekGNSAjgzeaRA6" name="ally mcbeal.jpg" alt="Calista Flockhart on Ally McBeal" src="https://cdn.mos.cms.futurecdn.net/hQDzd9aiekGNSAjgzeaRA6.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="the-dancing-baby-ally-mcbeal">The Dancing Baby (Ally McBeal)</h2><p>The CGI dancing baby from <em>Ally McBeal</em> became one of the biggest memes of the ‘90s when the popular legal drama series introduced the uncanny youngster. Though the baby can be seen as the manifestation of Ally’s inner turmoil, the thing looked so bad, so random, and so out of place.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="cqWAyYbbgeTSmPAQRhN8JE" name="Diagnosis Murder" alt="Dick Van Dyke on Diagnosis: Murder" src="https://cdn.mos.cms.futurecdn.net/cqWAyYbbgeTSmPAQRhN8JE.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="dr-mark-sloan-s-uncanny-ability-to-solve-crimes-diagnosis-murder">Dr. Mark Sloan's Uncanny Ability To Solve Crimes (Diagnosis: Murder) </h2><p>There were so many oddball crime shows in the ‘90s in the wake of <em>Murder She Wrote</em>. One of the most absurd has to be <em>Diagnosis: Murder</em>, which saw Dick Van Dyke play a doctor that – you guessed it – helped solve homicide cases. But here’s the thing: he was better at it than the detectives who do this every day of the week.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="ACEPiMR7FUHU3jhoRp4PhH" name="Mighty Morphin Power Rangers" alt="The Super Megaforce Power Rangers transformed into the Mighty Morphin' Rangers" src="https://cdn.mos.cms.futurecdn.net/ACEPiMR7FUHU3jhoRp4PhH.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Hasbro)</span></figcaption></figure><h2 id="angel-grove-constantly-being-destroyed-and-rebuilt-mighty-morphin-power-rangers">Angel Grove Constantly Being Destroyed And Rebuilt (Mighty Morphin’ Power Rangers)</h2><p><em>Mighty Morphin’ Power Rangers</em>, one of the best kids shows for those who grew up in the ‘90s, was absolutely bonkers looking back. But you know what’s crazier than teenagers turning into masked fighters to take on a witch from the Moon? Well, it has to be the fact that Angel Grove gets destroyed and rebuilt like nobody’s business each episode, and no one seems to notice.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="n6Jy5mnPcMGm6aAdu2eJNV" name="bellswan" alt="Zack and the girl dance on Saved by the Bell" src="https://cdn.mos.cms.futurecdn.net/n6Jy5mnPcMGm6aAdu2eJNV.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="zack-morris-being-able-to-graduate-despite-never-being-in-class-saved-by-the-bell">Zack Morris Being Able To Graduate Despite Never Being In Class (Saved By The Bell)</h2><p>Zack Morris, pretty much the king of Bayside High, did everything he could at school to not going to class, and he was mostly the class clown when he was in class. But somehow, someway, he was able to graduate with his friends and go on to college. Maybe, he should have been held back; we at least wouldn’t have had to sit through <em>Saved by the Bell: The College Years</em>.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="A7UsFxtthEq7SJfUqbgDNE" name="Oz Ernie Hudson.jpg" alt="Ernie Hudson in Oz" src="https://cdn.mos.cms.futurecdn.net/A7UsFxtthEq7SJfUqbgDNE.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO)</span></figcaption></figure><h2 id="warden-leo-glynn-not-being-canned-or-sent-to-prison-himself-oz">Warden Leo Glynn Not Being Canned Or Sent To Prison Himself (Oz)</h2><p>Anyone who’s watched a single episode of <em>Oz</em> knows that the prison at the center of the landmark HBO series wasn’t the best place to be. Despite riots, inmates sneaking in guns, inmates trapping people behind walls, and all sorts of madness, Oswald Pentitentiary Warden Leo Glynn kept his job. Make that make sense.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="uzSr2LqQ9zQ72pm5okdk" name="Picket Fences Tom Skerritt getting told off lovingly by Kathy Baker.jpg" alt="Tom Skerritt getting told off lovingly by Kathy Baker in Picket Fences." src="https://cdn.mos.cms.futurecdn.net/uzSr2LqQ9zQ72pm5okdk.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: 20th Television)</span></figcaption></figure><h2 id="can-we-talk-about-the-serial-killers-and-supernatural-phenomena-picket-fences">Can We Talk About The Serial Killers And Supernatural Phenomena (Picket Fences)</h2><p>Remember <em>Picket Fences</em>, the CBS drama series about life in a seemingly quiet small town filled with serial killers, supernatural phenomena, and a variety of other strange and distressing occurrences? This show had it all, except for maybe a realistic view of the world. Pure madness.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="zdu8HNdtHTAGwovUBv2CZ7" name="walker (1).jpg" alt="Chuck Norris on Walker, Texas Ranger" src="https://cdn.mos.cms.futurecdn.net/zdu8HNdtHTAGwovUBv2CZ7.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="ranger-cordell-walker-is-seemingly-bulletproof-walker-texas-ranger">Ranger Cordell Walker Is Seemingly Bulletproof (Walker, Texas Ranger)</h2><p>Insert Chuck Norris joke here. Seriously, his titular character from <em>Walker, Texas Ranger</em> was pretty much the bulletproof cowboy. Between the dodging bullets, scores of roundhouse kicks, and other heroics, it seems like it’s all too good to be true.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="NRi6iQ4ZgDawquiPNZWpN4" name="Pacific BLue" alt="Mario Lopez in Pacific Blue" src="https://cdn.mos.cms.futurecdn.net/NRi6iQ4ZgDawquiPNZWpN4.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: USA)</span></figcaption></figure><h2 id="bike-cops-do-what-normal-officers-can-t-pacific-blue">Bike Cops Do What Normal Officers Can't (Pacific Blue)</h2><p><em>Pacific Blue</em>, a show that was often the lead-in for <em>Monday Night Raw</em> on Monday nights, followed bicycle cops as they went about their days. But here’s the thing, they often pulled off feats (and bike stunts) that normal cops couldn’t match. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Rv6haBGYe77aymo8gCbUh3" name="Carmen Electra.jpg" alt="Carmen Electra on Baywatch." src="https://cdn.mos.cms.futurecdn.net/Rv6haBGYe77aymo8gCbUh3.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fremantle)</span></figcaption></figure><h2 id="the-lifeguards-do-way-more-than-save-people-at-the-beach-baywatch">The Lifeguards Do Way More Than Save People At The Beach (Baywatch)</h2><p>The last time we checked, lifeguards watched over the beaches for drowning swimmers, shark attacks, and missing kids. But if you watch <em>Baywatch</em>, you’ll see them do that plus defeat terrorists, help out in wrestling matches, and run on the beach in slow-motion. Not very realistic, right?</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="XsKv5NrzLiGp3iWV5mCjfj" name="angel.jpg" alt="Touched By An Angel cast" src="https://cdn.mos.cms.futurecdn.net/XsKv5NrzLiGp3iWV5mCjfj.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="no-one-thinks-angels-interfering-in-everyday-life-is-odd-touched-by-an-angel">No One Thinks Angels Interfering In Everyday Life Is Odd (Touched By An Angel)</h2><p>Everybody’s grandma’s favorite show, <em>Touched by an Angel</em>, followed a group of three heavenly visitors who helped people back on Earth make incredible decisions that mostly saw them take a more righteous path. But the fact that angels could interfere in people’s lives and not cause a stir (or end with a trip to the mental ward) is hard to believe.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="DDH9FVQUq7ywFC3UX2BngP" name="will smith fresh prince.jpg" alt="Will smiling at Uncle Phil in The Fresh Prince of Bel-Air" src="https://cdn.mos.cms.futurecdn.net/DDH9FVQUq7ywFC3UX2BngP.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Max)</span></figcaption></figure><h2 id="will-gets-into-princeton-after-solving-a-rubik-s-cube-the-fresh-prince-of-bel-air">Will Gets Into Princeton After Solving A Rubik's Cube (The Fresh Prince Of Bel-Air)</h2><p>Though he ended up not going to the Ivy League institution, the fact that Will received an offer to attend Princeton in <em>The Fresh Prince of Bel-Air</em> is just wild. But you know what’s crazier? It wasn’t the “Fresh Prince’s" charisma that impressed his interviewer, but instead his skill with a… Rubik’s Cube.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="uULUFS98Q25hi7oAhNiVYg" name="dinosaurssinclairs.jpg" alt="The Sinclairs from Dinosaurs" src="https://cdn.mos.cms.futurecdn.net/uULUFS98Q25hi7oAhNiVYg.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="all-kinds-of-90s-tech-and-luxuries-in-the-age-of-the-dinosaur-dinosaurs">All Kinds Of '90s Tech And Luxuries In The Age Of The Dinosaur (Dinosaurs)</h2><p>Okay, <em>Dinosaurs</em> was a meta deconstruction of the sitcom format with a family of dinos in place of the standard nuclear family. But, the thing that has always been so wild is the fact that the Sinclair family has all kinds of modern tech – TVs, radios, construction equipment, you name it, and it’s there.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="WKBG4ntM5cCxpD25EQpGfb" name="Beverly Hills 90210" alt="The car bomb in Beverly Hills, 90210" src="https://cdn.mos.cms.futurecdn.net/WKBG4ntM5cCxpD25EQpGfb.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="dylan-s-dad-dying-in-a-car-bomb-explosion-beverly-hills-90210">Dylan's Dad Dying In A Car Bomb Explosion (Beverly Hills, 90210)</h2><p>What started as a show about uber-rich kids living in one of the most exclusive zip codes in the world turned into a wild exploration of pretty much every TV genre by the time it was all said and done. One of the most insane plotlines in <em>Beverly Hills, 90210</em> was the one involving Dylan’s dad being blown up in a car bomb explosion, which would lead to the character played by <a href="https://www.cinemablend.com/television/2467784/luke-perry-riverdale-and-beverly-hills-90210-star-is-dead-at-52"><u>the late Luke Perry</u></a> trying to get to the bottom of the mystery.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="xLsgbXmPDxW2vRD4sM5UvJ" name="Party of Five Theme song.jpg" alt="The cast of Party of Five lounging on couches." src="https://cdn.mos.cms.futurecdn.net/xLsgbXmPDxW2vRD4sM5UvJ.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="unaccompanied-minors-going-on-with-their-lives-party-of-five">Unaccompanied Minors Going On With Their Lives (Party Of Five)</h2><p>Though the eldest of the five Salinger siblings in <em>Party of Five</em> was technically an adult, Charlie wasn’t that responsible, leaving his younger (and underage) brothers and sisters to do a lot of the heavy lifting. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Z6nED7Rsi7T5HrnEF6yBz7" name="California Dreams" alt="The California Dreams cast" src="https://cdn.mos.cms.futurecdn.net/Z6nED7Rsi7T5HrnEF6yBz7.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="the-school-band-balance-is-not-sustainable-california-dreams">The School/Band Balance Is Not Sustainable (California Dreams)</h2><p>Do you remember the ‘90s teen comedy <em>California Dreams</em>? No? Well, imagine <em>Saved by the Bell,</em> but the main characters also have to balance school with being in a successful rock band. Somehow, they’re able to balance both worlds while not getting too stressed out or falling behind. Anyone who has been in a band before knows this is a dream.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="GN5esec88UvKsFDTeAGQu6" name="controversymarried" alt="Al and Peg in court on Married... with Children" src="https://cdn.mos.cms.futurecdn.net/GN5esec88UvKsFDTeAGQu6.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="how-is-al-bundy-s-family-not-in-serious-debt-married-with-children">How Is Al Bundy's Family Not In Serious Debt? (Married... With Children)</h2><p>Before <em>Married… with Children</em> <a href="https://www.cinemablend.com/television/moment-shows-jumped-the-shark"><u>jumped the shark</u></a>, it gave TV viewers some of the funniest (and most uncomfortable) moments. But one thing that has always been baffling is the fact that Al Bundy was able to have a decent-sized house, raise two kids, and have a shopaholic wife by working at a shoe store. How did they not go into debt?</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="4usR6n5o6gLRh6PVx3k72M" name="Step By Step Susanne Somers looks disappointed as Patrick Duffy stands holding a plane.jpg" alt="Suzanne Somers looks disappointed as Patrick Duffy stands holding a plane in Step By Step." src="https://cdn.mos.cms.futurecdn.net/4usR6n5o6gLRh6PVx3k72M.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros. TV)</span></figcaption></figure><h2 id="how-did-the-family-afford-that-disney-trip-step-by-step">How Did The Family Afford That Disney Trip? (Step By Step)</h2><p>Despite being one of the <a href="https://www.cinemablend.com/television/10-Greatest-TGIF-Comedies-All-Time-Ranked-120697.html"><u>greatest TGIF comedies</u></a>, <em>Step by Step</em> was a show with a lot of problems. Not to harp too much on finances, but how did that massive family afford to go on an all-inclusive trip to Disney? How many people was that again?</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="b3Vx4sN2ttiHvGANG9Nsu7" name="Lucy and Simon in 7th Heaven.jpg" alt="Lucy and Simon in 7th Heaven" src="https://cdn.mos.cms.futurecdn.net/b3Vx4sN2ttiHvGANG9Nsu7.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: The WB)</span></figcaption></figure><h2 id="how-many-moral-dilemmas-can-one-family-face-and-overcome-7th-heaven">How Many Moral Dilemmas Can One Family Face And Overcome? (7th Heaven)</h2><p>The Camden family had one moral dilemma after another over the course of <em>7th Heaven</em>’s 11-season run, so much so that it got exhausting by the time the show ended in 2007. At times, it felt like this family had a black cloud hanging over them or was placed under some kind of curse.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="a9YKhLEUQF3TnpZkZFdrwg" name="The-Secret-World-of-Alex-Mack-Featured.jpg" alt="Larisa Oleynik in The Secret World of Alex Mack" src="https://cdn.mos.cms.futurecdn.net/a9YKhLEUQF3TnpZkZFdrwg.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Nickelodeon)</span></figcaption></figure><h2 id="the-origins-of-alex-mack-s-powers-the-secret-world-of-alex-mack">The Origins Of Alex Mack's Powers (The Secret World Of Alex Mack)</h2><p><em>The Secret World of Alex Mack</em> was a <a href="https://www.cinemablend.com/television/the-top-12-nickelodeon-tv-shows-of-the-90s"><u>massive ‘90s Nickelodeon show</u></a> about a young girl who gains some wild powers after coming in contact with a mysterious substance. How does she come in contact, exactly? Well, she is nearly hit by a truck containing the stuff in a company town owned by her father’s employer. What year is this again?</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="u4djH8tzho3ofTZ3F6xC78" name="The Buffy the Vampire Slayer cast stand together outside in the daylight" alt="The Buffy the Vampire Slayer cast stand together outside in the daylight in the series finale." src="https://cdn.mos.cms.futurecdn.net/u4djH8tzho3ofTZ3F6xC78.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: 20th Century Fox Television)</span></figcaption></figure><h2 id="the-whole-high-school-on-a-demonic-portal-aspect-of-the-show-buffy-the-vampire-slayer">The Whole ‘High School On A Demonic Portal' Aspect Of The Show (Buffy The Vampire Slayer)</h2><p>Everyone loves <em>Buffy the Vampire Slayer</em> here, so no judging. One thing that’s always been so funny about the show is the fact that Sunnydale High School was built over the Hellmouth, a literal portal to a demon realm. Why not just close the school down?</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="H7BJgnTRxecwNZAci7ZNZa" name="kel orange.jpg" alt="Kel Mitchell on Kenan & Kel" src="https://cdn.mos.cms.futurecdn.net/H7BJgnTRxecwNZAci7ZNZa.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Nickelodeon)</span></figcaption></figure><h2 id="kel-s-constant-destruction-has-no-consequences-kenan-kel">Kel's Constant Destruction Has No Consequences (Kenan & Kel)</h2><p>Following the success of <em>All That</em>, Kenan Thompson and Kel Mitchell got their own show: <em>Kenan & Kel</em>. It’s impossible to count how many times Kel’s character caused massive amounts of damage to houses, stores, restaurants, and schools, facing little to no consequences.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ Fuller House Gave Jodie Sweetin ‘A Whole New Appreciation’ For Growing Up On Full House, And I Love How Thoughtful Her Take Is ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/fuller-house-gave-jodie-sweetin-a-whole-new-appreciation-for-growing-up-on-full-house-thoughtful-take</link>
                                                                            <description>
                            <![CDATA[ The furthest thing from rude. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">TRNJw73SzJKChPMLB9zGY5</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/VVoXW6oBh6RXQNToNbg4Aa-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Tue, 06 May 2025 13:24:19 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Maggie Sheck ]]></dc:creator>                                                                                                        <dc:description><![CDATA[ null ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/VVoXW6oBh6RXQNToNbg4Aa-1280-80.jpg">
                                                            <media:credit><![CDATA[Netflix / ABC]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Side by side of Jodie Sweetin as Stephanie Tanner in Fuller House and Full House.]]></media:description>                                                            <media:text><![CDATA[Side by side of Jodie Sweetin as Stephanie Tanner in Fuller House and Full House.]]></media:text>
                                <media:title type="plain"><![CDATA[Side by side of Jodie Sweetin as Stephanie Tanner in Fuller House and Full House.]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/VVoXW6oBh6RXQNToNbg4Aa-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>It's honestly hard to believe that we're about to hit the five-year anniversary of <em>Fuller House</em>'s series finale. The <em>Full House</em> sequel series famously reunited the original cast, including Jodie Sweetin, as she reprised her role as Stephanie Tanner. Sweetin is one of a select group of actors who's been able to reprise a role she played as a child. Now, she's explaining how that opportunity impacted her view of the OG series, and I love her take.</p><p>It's no secret that to this day, <em>Full House</em> remains one of the most <a href="https://www.cinemablend.com/television/10-Greatest-TGIF-Comedies-All-Time-Ranked-120697.html">beloved TGIF shows</a> from the '90s. During an interview with <a href="https://people.com/jodie-sweetin-opens-up-about-full-house-days-and-being-a-nostalgic-figure-exclusive-11723987">People</a>, Jodie Sweetin was specifically asked about the enduring popularity of the series and her time on the spinoff. It would seem that her stint on the newer show, which is available to stream with a <a href="https://www.cinemablend.com/streaming-news/netflix-subscription-the-plans-the-price-and-whats-included">Netflix subscription</a>, helped her shed some preconceived notions she had as a teen actor:</p><div><blockquote><p>It gave me a whole new appreciation for what the show means to fans. There was probably an age when the show finished and I was in high school and a teenager that it was just so uncool, but I mean, the wind could blow the wrong way. You were like, ‘Oh my God, I'm so uncool. Everything's ruined.’ So I think that was the mentality.</p></blockquote></div><p>Considering the somewhat cheesy and goofy nature of the ABC sitcom, it's understandable as to why Jodie Sweetin felt somewhat embarrassed as a teen. Regardless of that, <em>Full House </em>(which you can stream with a <a href="https://www.cinemablend.com/television/2570432/subscribing-to-hbo-max-what-to-know-about-the-price-options-and-what-the-streaming-service-offers">Max subscription</a>) still struck a chord with viewers. Sweetin's own performance as the cheeky Stephanie also garnered much love from fans.</p><p>Sweetin recalled that her own feelings shifted with every passing year. What I love about the actress' comments is the fact that her comments indicate a natural sense of maturity that come with age. With that, she's also come to realize just how important this TV franchise is to so many people, which I love. And, with that, comes a considerable amount of gratitude as well:</p><div><blockquote><p>But as I've gotten older and as those around me who have also gotten older now appreciate what it was and the show and the feelings of it, it's just changed my perspective. It's a huge honor to get to be part of something that so many people find comfort in, and there's not many opportunities or careers where that gets to happen. And so I am incredibly grateful for that. I still love what I do. I still love entertaining, I love comedy. And it's because people fell in love with Full House and Stephanie and have continued to, so I'm just beyond grateful for it.</p></blockquote></div><div  class="fancy-box"><div class="fancy_box-title">More on Jodie Sweetin</div><div class="fancy_box_body"><figure class="van-image-figure "  ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="6ahsDSjZb9od4FYz7fCbw6" name="Jodie Sweetin and CCB.jpg" caption="" alt="Jodie Sweetin and Candace Cameron Bure on Fuller House." src="https://cdn.mos.cms.futurecdn.net/6ahsDSjZb9od4FYz7fCbw6.jpg" mos="" link="" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pinterest-pin-exclude"></p></div></div><figcaption itemprop="caption description" class=""><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><p class="fancy-box__body-text"><a data-analytics-id="inline-link" href="https://www.cinemablend.com/television/full-house-jodie-sweetin-never-actually-feuding-candace-cameron-bure-traditional-marriage-beliefs-very-different-worlds">Full House’s Jodie Sweetin Opens Up Years After ‘Never Actually’ Feuding With Candace Cameron Bure Over ‘Traditional Marriage' Beliefs, But It’s Clear They’re From ‘Very Different Worlds'</a></p></div></div><p>It’s so wonderful to hear that <em>The Heiress and the Handyman</em> alum now has such a positive perception of the sitcom that made her a star. This is quite significant, considering that just several years ago, Sweetin admitted to <a href="https://www.cinemablend.com/television/1706500/apparently-jodie-sweetin-is-the-only-person-on-earth-who-has-never-watched-a-full-house-episode">not having seen a <em>Full House</em> episode</a>. Now, she <a href="https://www.cinemablend.com/television/jodie-sweetin-dave-coulier-launched-full-house-podcasts-love-fest-bob-saget">hosts a rewatch podcast</a>, <em>How Rude, Tanneritos!</em>, alongside co-star Andrea Barber, on which they dig deep into each installment of the eight-season show.</p><p>As for <em>Fuller House</em>, the show allows for Stephanie to grow in a myriad of ways. She blows in from London to help sister D.J. raise her children and, by the end of the show, she's a married woman with a child of her own on the way.</p><p>Overall, Jodie Sweetin seems to still hold a special place in her heart for both <em>Full House</em> and its follow-up, which I love so much. She even <a href="https://www.cinemablend.com/television/whatever-happened-to-full-house-mr-bear-jodie-sweetin-explains-stuffed-toy-today">still owns Stephanie's Mr. Bear</a>, and that's a testament to her affection for the series. Hopefully, Sweetin will continue to hold onto the positive feelings she has. Right now, you can stream both shows at your leisure, and check out the <a href="https://www.cinemablend.com/streaming-news/2025-netflix-movie-tv-show-release-dates">2025 Netflix TV schedule</a> for recently released comedy series.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ Full House’s Jodie Sweetin Opens Up Years After ‘Never Actually’ Feuding With Candace Cameron Bure Over ‘Traditional Marriage' Beliefs, But It’s Clear They’re From ‘Very Different Worlds' ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/full-house-jodie-sweetin-never-actually-feuding-candace-cameron-bure-traditional-marriage-beliefs-very-different-worlds</link>
                                                                            <description>
                            <![CDATA[ Jodie Sweetin set the record straight. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">xEYdXYgVtKQEwvNnmqmyoR</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/6ahsDSjZb9od4FYz7fCbw6-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Sat, 03 May 2025 16:27:09 +0000</pubDate>                                                                                                                                <updated>Sat, 03 May 2025 22:45:25 +0000</updated>
                                                                                                                                            <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Erik Swann ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/rXkznL7DwWNoGfjx998J3Q.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Erik Swann is a Senior Content Producer at CinemaBlend. He began working with the publication in 2020 when he was hired as Weekend Editor. Today, he continues to write, edit and handle social media responsibilities over the weekend. On weekdays, he also writes TV and movie-related news and helps out with editing and social media as needed. He graduated from the University of Maryland, where he received a degree in Broadcast Journalism. After shifting into multi-platform journalism, he started working as a freelance writer and editor before joining CB. During his time with the site, he&#039;s been able to cover some excellent TV shows and films and interview some wonderful stars.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Into&lt;/strong&gt;: Erik is a superhero fan, and his love for comic books began after he first watched Batman: The Animated Series as a child. He also enjoys comedies, action/adventure flicks, dramas and science fiction. He has a love for sports as well, particularly professional basketball. Though he&#039;s a Maryland/Washington D.C. native, he roots for the Boston Celtics. Some of his all-time favorite TV shows are BTAS, Breaking Bad, Sanford and Son, Agents of S.H.I.E.L.D., Better Call Saul and Atlanta. And when it comes to movies, Beverly Hills Cop, A Raisin in the Sun, Toy Story, Iron Man, Star Wars, and Wall Street are among his favorites. He also enjoys a good pizza (preferably with pepperoni and mushrooms) while he&#039;s watching entertaining films and TV series.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Excited About Right Now&lt;/strong&gt;: Teenage Mutant Ninja Turtles: Mutant Mayhem, Reservation Dogs Season 3, Ahsoka, Loki Season 2, Invincible Season 2, Next Goal Wins and Chicken Run: Dawn of the Nugget.&lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/6ahsDSjZb9od4FYz7fCbw6-1280-80.jpg">
                                                            <media:credit><![CDATA[Netflix]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Jodie Sweetin and Candace Cameron Bure on Fuller House.]]></media:description>                                                            <media:text><![CDATA[Jodie Sweetin and Candace Cameron Bure on Fuller House.]]></media:text>
                                <media:title type="plain"><![CDATA[Jodie Sweetin and Candace Cameron Bure on Fuller House.]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/6ahsDSjZb9od4FYz7fCbw6-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>For eight seasons, Jodie Sweetin and Candace Cameron Bure starred as sisters on the hit ABC sitcom <em>Full House</em> and, years later, they reprised their roles for the sequel series, <em>Fuller House</em>. The ensemble casts of both shows are famously close, and that’s long been the case for Bure and Sweetin. However, their relationship seemed to hit a rough patch after Bure made comments about “traditional marriage” as it pertained to her new gig at Great American Family. Now, Sweetin is getting real about what actually went down between them.</p><p>Candace Cameron Bure, who’d long worked with Hallmark, left the network for Great American Family in 2022. Around that time, the veteran actress gave an interview in which she said that the movies she’d produce for the company would keep “traditional marriage” at its core. JoJo Siwa, <a href="https://www.cinemablend.com/television/ex-hallmark-star-hilarie-burton-went-off-on-candace-cameron-bure-after-gaf-star-said-new-movies-will-feature-traditional-marriages">Hilarie Burton and more chastised Bure</a> for her remarks, and Jodie Sweetin later chimed in, without specifically naming her former co-star as well. Making note of her <a href="https://www.cinemablend.com/television/jodie-sweetin-speaks-out-on-being-an-lgbtq-ally-after-brouhaha-over-candace-cameron-bures-traditional-marriage-comments">status as an LGBTQ+ ally</a>, Sweetin defended Siwa and expressed support. </p><p>The longtime Stephanie Tanner actress’ activism came up during her appearance on <a href="https://open.spotify.com/episode/74BqRMVqAl2LgSIamZ074c"><em>The Vault Podcast</em></a>. One of the co-hosts noted that she and her co-star hold very differing views and said that the two had “gotten into it” due to their difference of opinion on the LGBTQ+ community. However, the star went on to provide some clarity on that front: </p><div><blockquote><p>We never actually got into it. She posted sort of her viewpoint, and I posted mine. We’ve always been very different on those things, and I think it was just that now all of that sort of comes to the surface more. And people — for me, I find that if I can be of service or help with whatever gift I’ve been given of people paying attention, that it is required of me to do something important with that. And, for me, something important is looking out for my queer siblings that I love and the family that’s out there that doesn’t need more shit added on. </p></blockquote></div><p>Jodie Sweetin was later asked to shed a bit more light on the nature of her relationship with Candace Cameron Bure, specifically in regard to how they interact with each other at public events. With that, Sweetin went on to describe what sounds like a relatively civil relationship akin to one between relatives:</p><div><blockquote><p>I think Candace and I – we’ve just live very different lifestyles, you know? We just exist in sort of very different worlds, but she is still someone who I’ve known since I was 5 years old. It’s like family members, where you’re like, maybe we don’t talk all the time, and I know if politics come up, it is not going to go well, but I don’t hate you. I’m not gonna not hug you, but I am also not gonna keep my mouth shut.</p></blockquote></div><div  class="fancy-box"><div class="fancy_box-title">More on Jodie Sweetin</div><div class="fancy_box_body"><figure class="van-image-figure "  ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="sZ8XMGdYtJTdXhh4CLmThG" name="Jodie Sweetin and CCB2.jpg" caption="" alt="Jodie Sweetin as Stephanie Tanner and Candace Cameron Bure as DJ Tanner on Full House." src="https://cdn.mos.cms.futurecdn.net/sZ8XMGdYtJTdXhh4CLmThG.jpg" mos="" link="" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pinterest-pin-exclude"></p></div></div><figcaption itemprop="caption description" class=""><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros.)</span></figcaption></figure><p class="fancy-box__body-text"><a data-analytics-id="inline-link" href="https://www.cinemablend.com/television/why-jodie-sweetin-closer-to-mary-kate-ashley-olsen-than-candace-cameron-bure-during-full-house">Jodie Sweetin Explains Why She Was Much Closer To Mary-Kate And Ashley Olsen Than Candace Cameron Bure While Filming Full House</a></p></div></div><p>Shortly after the “traditional marriage” brouhaha, it was suggested that there was beef between the two former child stars. It appeared that <a href="https://www.cinemablend.com/television/after-jodie-sweetin-supported-jojo-siwa-during-traditional-marriage-controversy-candace-cameron-bure-seemingly-unfollowed-her-on-social-media">Candace Cameron Bure unfollowed</a> her former co-star on social media. Around that time an unnamed <a href="https://www.cinemablend.com/television/update-on-whats-allegedly-going-on-between-full-house-stars-candace-cameron-bure-and-jodie-sweetin-after-kerfuffle-over-traditional-marriage-comments">source also alleged that Bure was unhappy</a> with Jodi Sweetin making public comments as opposed to speaking about the matter with her one on one. On top of that, Bure was also candid about the backlash she received, saying <a href="https://www.cinemablend.com/television/candace-cameron-bure-candid-about-cancel-culture-after-now-infamous-traditional-marriage-comments">she’d never experienced that kind of blowback</a>. </p><p>Though Jodie Sweetin and Candace Cameron Bure eventually <a href="https://www.cinemablend.com/television/jodie-sweetin-candace-cameron-bure-feud-full-house-co-star-calls-out-not-liking-last-supper-olympics-opening-ceremony">disagreed again over the “last supper”</a> moment at the 2024 Summer Olympics, it’d been reported that the two are on relatively good terms. In 2023, <a href="https://www.cinemablend.com/television/candace-cameron-bure-jodie-sweetin-reuniting-after-traditional-marriage-disagreement-full-house">they also reunited at ‘90s Con</a> alongside co-stars Dave Coulier, Andrea Barber and more. Based on Sweetin’s comments and what’s transpired in the time since Bure’s comments hit the web, it seems the two still love and respect each other, even if they don’t see eye to eye on every topic.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ The Best Episode From 32 Classic Sitcoms ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/best-episode-from-classic-sitcoms</link>
                                                                            <description>
                            <![CDATA[ The best of the best and funniest. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">EEpiZ4dJreTfCNNMfxVrvU</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/rjkppsLKR5ZFXRnQjEqWQ3-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Wed, 30 Apr 2025 17:31:00 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Hugh Scott ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/gqJyioXTNQbSAisiNzZfAG.jpeg ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;The Background: Hugh Scott is the Syndication Editor for CinemaBlend. Before CinemaBlend, he was the managing editor for Suggest.com and Gossipcop.com, covering celebrity news and debunking false gossip. He has been in the publishing industry for almost two decades, covering pop culture – movies and TV shows, especially – with a keen interest and love for Gen X culture, the older influences on it, and what it has since inspired.&amp;nbsp;&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;He graduated from Boston University with a degree in Political Science but cured himself of the desire to be a politician almost immediately after graduation.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;What He&#039;s Into: When not writing and editing, he is usually going to concerts, curating playlists on Spotify, or watching concert films. In addition to music, he cooks, cleans, and fixes things around the house, especially things his 10-pound terror of a dog has destroyed in a fit of bordem.&amp;nbsp;&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;What He&#039;s Excited About Right Now: &amp;nbsp;Trips to the Cayman Islands and Alaska in 2024, and, as always, all the upcoming concerts he plans to attend.&amp;nbsp;&lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/rjkppsLKR5ZFXRnQjEqWQ3-1280-80.jpg">
                                                            <media:credit><![CDATA[NBCU Photo Bank/NBCUniversal via Getty Images via Getty Images]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[The cast of Cheers gathered around the bar]]></media:description>                                                            <media:text><![CDATA[The cast of Cheers gathered around the bar]]></media:text>
                                <media:title type="plain"><![CDATA[The cast of Cheers gathered around the bar]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/rjkppsLKR5ZFXRnQjEqWQ3-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>People have a lot of opinions on sitcoms, and the more popular, the more opinions there are. So, for this, our list of the best episodes of the best sitcoms, we combed through sites like IMDB and Rotten Tomatoes to see if we could find a consensus. It's probably not perfect, and opinions will vary, but at the very least, it's as close as a list can get to all the best episodes of these classic sitcoms from every era of television. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="5U3KVNABMS8SuSy4zh8WjM" name="Seinfeld Jason Alexander Jerry Seinfeld and Julia Louis-Dreyfus stand in shock in Jerry's apartment.jpg" alt="Jason Alexander Jerry Seinfeld and Julia Louis-Dreyfus stand in shock in Jerry's apartment in Seinfeld." src="https://cdn.mos.cms.futurecdn.net/5U3KVNABMS8SuSy4zh8WjM.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Castle Rock Entertainment)</span></figcaption></figure><h2 id="seinfeld-the-contest">Seinfeld - The Contest</h2><p>There is no question that "The Contest" in Season 4 ranks among <a href="https://www.cinemablend.com/television/the-best-seinfeld-episodes-ranked">the best episodes of <em>Seinfeld</em></a><em> </em>ever. There may be one or two episodes that compete for that top spot, as would be expected from a show as beloved as <em>Seinfeld, </em>but just hearing Kramer yell "I'm out!" is enough for us to include it on this list. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="gs3gkaGhMxEjKGRU3D4rwN" name="modernfamily.jpg" alt="Modern Family." src="https://cdn.mos.cms.futurecdn.net/gs3gkaGhMxEjKGRU3D4rwN.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Peacock)</span></figcaption></figure><h2 id="modern-family-caught-in-the-act">Modern Family - Caught In The Act</h2><p>Everyone fears walking in on their parents doing the deed, and that's the aptly titled "Caught In The Act" in Season 2 of <em>Modern Family</em>. The episode hilariously explores that one thing that everyone can relate to. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="9uRsGKYsj78Kr2LqqP4dTH" name="Screenshot 2024-04-09 004606.jpg" alt="Bea Arthur as Dorothy Zbornak and Betty White as Rose Nylund in The Golden Girls episode "The Days and Nights of Sophia Petrillo"" src="https://cdn.mos.cms.futurecdn.net/9uRsGKYsj78Kr2LqqP4dTH.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Hulu)</span></figcaption></figure><h2 id="the-golden-girls-one-flew-out-out-of-cuckoo-s-nest">The Golden Girls - One Flew Out Out Of Cuckoo's Nest</h2><p>Over the many years it ran, <em>The Golden Girls</em> just kept getting better. In fact, it's rare to see a series finale be ranked among the best ever, but that is the case with "One Flew Out Out Of Cuckoo's Nest." The classic NBC came to a wonderful conclusion with a couple of marriages and a move out of Florida. It does have some of those <a href="https://www.cinemablend.com/television/great-insults-from-the-golden-girls">classic <em>Golden Girls </em>insults,</a> though! What a way to end! </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="XumAv4F7Ecz4sATgNbmhWN" name="good times.png" alt="J.J. in Good Times." src="https://cdn.mos.cms.futurecdn.net/XumAv4F7Ecz4sATgNbmhWN.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="good-times-the-evans-get-involved-part-1">Good Times - The Evans Get Involved: Part 1</h2><p>Sometimes the best episodes are not necessarily the funniest. Take, for example, "The Evans Get Involved: Part 1" from Season 5 of <em>Good Times</em>. Not only does it introduce Penny, played by a young Janet Jackson, who would become a major character going forward, but it also addresses the deadly serious subject of abuse. So, it's not the funniest, but it is great TV. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Nxair3jNRnmJWNRjqjhC29" name="marcia the brady bunch.png" alt="Jan in The Brady Bunch." src="https://cdn.mos.cms.futurecdn.net/Nxair3jNRnmJWNRjqjhC29.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="the-brady-bunch-the-subject-was-noses">The Brady Bunch - The Subject Was Noses</h2><p>Multiple generations grew up watching <em>The Brady Bunch,</em> and when asked about episodes, it's inevitable that many will immediately cite Marcia's broken nose episode as one of their favorites and certainly one of the most memorable. The episode, from Season 4, is a classic, and the ridiculousness of the football hitting Marcia in the face is one of the best moments in TV history. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="HtWXwJGYusogBS536qpPo3" name="Scrubs Turk Cox" alt="Turk and Dr. Cox standing cross-armed in Sacred Heart break room in Scrubs" src="https://cdn.mos.cms.futurecdn.net/HtWXwJGYusogBS536qpPo3.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="scrubs-my-best-friend-s-baby-s-baby-and-my-baby-s-baby">Scrubs - My Best Friend's Baby's Baby and My Baby's Baby</h2><p>The second episode of Season 4 of <em>Scrubs</em>, "My Best Friend's Baby's Baby and My Baby's Baby," takes the top spot for the medical comedy. Honestly, just the title is perfect for the show's over-the-top nature and earns it this spot on the list. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="teVwypzMqknhwQfJNnCZAg" name="all in the family.jpg" alt="Carroll O'Connor and Jean Stapleton on All in the Family" src="https://cdn.mos.cms.futurecdn.net/teVwypzMqknhwQfJNnCZAg.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="all-in-the-family-too-good-edith">All In The Family -  Too Good Edith</h2><p><em>All In The Family</em> was never afraid to blur the lines between drama and comedy and take on heavy subjects. The series finale, after nine incredible seasons, takes the top spot here. Titled "Too Good Edith," the show explores the love Archie has for Edith and his fear of her death. The death comes off-screen, after the show concluded, and is dealt with the the show's sequel series, <em>Archie's Place</em>. A fitting end to the classic show. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="guhZtvPacwYjKHAjCY4FcH" name="Frank Grimes Azaria" alt="Frank Grimes looking angry in The Simpsons" src="https://cdn.mos.cms.futurecdn.net/guhZtvPacwYjKHAjCY4FcH.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="the-simpsons-homer-s-enemy">The Simpsons - Homer's Enemy</h2><p>Ask 100 fans of <em>The Simpsons</em> what <a href="https://www.cinemablend.com/television/2570799/the-ten-best-episodes-of-the-simpsons-to-watch-if-youre-new-to-the-show">the best episode is</a>, and you'll probably get 100 different answers (though anyone who says anything after Season 10 is wrong). The most popular answer on the internet seems to be "Homer's Enemy" from Season 8, which tells the story of Homer's hapless co-worker Frank Grimes, aka "Grimsy," may he rest in peace. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="cWms2Fj4wx5Bsv3p97s68" name="community.jpg" alt="The study group in Community" src="https://cdn.mos.cms.futurecdn.net/cWms2Fj4wx5Bsv3p97s68.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="community-modern-warfare">Community - Modern Warfare</h2><p>Ah, the famous paintball episode of <em>Community</em>. It feels like all we really need to say here is, "If you know, you know."</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="y35xoEqVpURkXuiiRpNLJF" name="familyguy.jpg" alt="The Griffin family sitting on a couch" src="https://cdn.mos.cms.futurecdn.net/y35xoEqVpURkXuiiRpNLJF.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="family-guy-road-to-the-multiverse">Family Guy - Road To The Multiverse</h2><p>Years before the <a href="https://www.cinemablend.com/news/2467680/a-marvel-movies-timeline-to-watch-from-beginning-to-endgame">MCU movies</a> took us into the multiverse, <em>The Family Guy</em> offered us a "Road to the Multiverse" in Season 8. It's a little surprising that this one is so loved by fans. It's a great episode, but it's also very different from a standard episode. Sometimes going this far astray doesn't work, but Seth McFarlane and his crack crew nailed it here. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="KnU8E6zhxFvNggEUsxZR6A" name="Bull Finch Cheers.jpg" alt="The exterior of Cheers on the show" src="https://cdn.mos.cms.futurecdn.net/KnU8E6zhxFvNggEUsxZR6A.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="cheers-one-for-the-road">Cheers - One For The Road</h2><p>It turns out that fans actually kind of love series finales. "One for the Road" was the last episode of the classic sitcom <em>Cheers</em>, and while it's a great ending to the show, there are funnier episodes, for sure. Still, these episodes clearly rank highly for many shows. The same probably can't be said for dramas like <em>Game of Thrones</em> and <em>Lost. </em></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="9Nx7G97H2qa4Fzr2obBwd7" name="bobdenvergilligansisland.jpg" alt="Bob Denver on Gilligan's Island" src="https://cdn.mos.cms.futurecdn.net/9Nx7G97H2qa4Fzr2obBwd7.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="gilligan-s-island-don-t-bug-the-mosquitoes">Gilligan's Island - Don't Bug The Mosquitoes</h2><p>It's become cliche to joke about all the visitors who came to the castaways' island in <em>Gilligan's Island</em>, only to leave without the poor stranded folks on the island. So that's not what we'll do here, but "Don't Bug The Mosquitoes" from Season 2 is a prime example of just how ridiculous (and great) the show was. The Mosquitoes are pretty much a parody of mid-'60s rock stars, just as cheesy as you'd expect from the show. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="VvNg43YAY3cATox5DfvBkM" name="oddcoupleklugmanrandall" alt="Tony Randall as Felix disappointed that Jack Klugman as Oscar has sprayed disinfectant in his food on The Odd Couple" src="https://cdn.mos.cms.futurecdn.net/VvNg43YAY3cATox5DfvBkM.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="the-odd-couple-password">The Odd Couple - Password</h2><p>There really isn't a funnier premise than Felix and Oscar from <em>The Odd Couple</em> trying to work together on a game show like <em>Password</em>, as they did on this episode from Season 3 of the classic sitcom. Hijinks ensue! </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="bPjvLg3GDxYDNRWa2UfZzT" name="friends phoebe my eyes" alt="Phoebe screaming in Friends" src="https://cdn.mos.cms.futurecdn.net/bPjvLg3GDxYDNRWa2UfZzT.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros. Television)</span></figcaption></figure><h2 id="friends-the-one-where-everybody-finds-out">Friends - The One Where Everybody Finds Out</h2><p>Like a lot of really popular shows on this–and few shows ever have been as popular as <em>Friends–</em>there are sure to be people who disagree that the Season 7 episode "The One Where Everybody Finds Out" is the best. But c'mon, Phoebe yelling "My eyes!" is classic <em>Friends!</em></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="AxfeLCn2x5C4rwC4RX8Lcc" name="ava fire abbott elementary" alt="From left to right: Sheryl Lee Ralph holding Ava's shoulder, Tyler James Williams looking down, Janelle James looking forward, Lisa Ann Walter hiding behind Janelle's shoulder, Quinta Brunson looking scared and Chris Perfetti gasping." src="https://cdn.mos.cms.futurecdn.net/AxfeLCn2x5C4rwC4RX8Lcc.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney/Gilles Mingasson)</span></figcaption></figure><h2 id="abbott-elementary-volunteers">Abbott Elementary - Volunteers</h2><p><em>Abbott Elementary</em> seems to be an unstoppable force. The multiple Emmy-winning show is probably the best sitcom of the 2020s, and it's because of episodes like "Volunteers." Though there is likely some recency bias baked in the reviews here, as it's a relatively new episode, coming from Season 4. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="5xmFxoHCNG82oc3NUKYBSn" name="WKRP Turkey.jpg" alt="Richard Sanders in WKRP in Cincinnati" src="https://cdn.mos.cms.futurecdn.net/5xmFxoHCNG82oc3NUKYBSn.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="wkrp-in-cincinnati-turkeys-away">WKRP In Cincinnati - Turkeys Away</h2><p><em>WKRP In Cincinnati</em> is an all-time great sitcom, and this episode, the Thanksgiving episode from Season 1 titled "Turkeys Away" is almost certainly considered by all of the show's fans to be the best–or at the least in the top two or three. It's a show where clips still get shared every Thanksgiving, even decades after the show aired. And no, Les, turkeys can't fly. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="DYtMVLQuzPpjZreMctx9od" name="I love lucy" alt="Lucy Ricardo in Vitameatavegimin commercial episode of I Love Lucy" src="https://cdn.mos.cms.futurecdn.net/DYtMVLQuzPpjZreMctx9od.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="i-love-lucy-l-a-at-last">I Love Lucy - L.A. At Last!</h2><p>What would sitcoms be without <em>I Love Lucy? </em>The pioneering show starring the legendary Lucille Ball broke ground in more ways than we could ever talk about on this list. Books have been written about it. The Season 4 episode, "L.A. At Last!" is a classic episode, as Lucy and Desi go to Los Angeles and rub shoulders with the stars... with predictably disastrous results. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="n7yzokCEUA8724tgYy2MTZ" name="GOB banner.jpg" alt="The cast of Arrested Development on Season 3 Episode 3." src="https://cdn.mos.cms.futurecdn.net/n7yzokCEUA8724tgYy2MTZ.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="arrested-development-development-arrested">Arrested Development - Development Arrested</h2><p>Season 3 of <em>Arrested Development</em> was supposed to be the series finale for the show that always seemed in danger of imminent cancellation.  The episode, called "Development Arrested," does a great job of tying a bow on the series and, like pretty much every episode from those first three years, is absolutely hilarious. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="AusSRoMPbkiXBqRudpz2Pg" name="schitt copy.jpg" alt="David and Patrick's wedding Schitt's Creek" src="https://cdn.mos.cms.futurecdn.net/AusSRoMPbkiXBqRudpz2Pg.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBC)</span></figcaption></figure><h2 id="schitt-s-creek-happy-ending">Schitt's Creek - Happy Ending</h2><p>Yet another series finale of a classic sitcom that tops the list of best episodes is "Happy Ending" from <em>Schitt's Creek</em>. It's a <a href="https://www.cinemablend.com/television/2556970/schitts-creek-how-things-ended-for-each-major-character">mostly happy ending for everyone</a>, especially David and Patrick, as they finally get married after a <em>lot </em>of hassle! </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="L9heAfT2nrHYGVmtS8VbXn" name="Untitled-20.jpg" alt="Larry David on curb your enthusiasm" src="https://cdn.mos.cms.futurecdn.net/L9heAfT2nrHYGVmtS8VbXn.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO)</span></figcaption></figure><h2 id="curb-your-enthusiasm-the-doll">Curb Your Enthusiasm - The Doll</h2><p>There is nothing unique about "The Doll" from <em>Curb Your Enthusiasm; </em>it's just classic <em>Curb</em>, with Larry getting angry over mundane things, like how to act in a movie theater and locks on bathrooms (or the lack thereof). There are so <a href="https://www.cinemablend.com/television/funniest-curb-your-enthusiasm-episodes-ranked">many great episodes</a> of the cringy classic that picking one is impossible, but this one is as good as any, and definitely one of the best. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="5446zEfveX8Ebpxktpn94R" name="Painted Ladies Full House.jpg" alt="A shot of the cast of Full House in a park in front of the Painted Ladies in San Francisco" src="https://cdn.mos.cms.futurecdn.net/5446zEfveX8Ebpxktpn94R.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="full-house-secret-admirer">Full House - Secret Admirer</h2><p>For a certain generation, <em>Full House</em> will forever be an important part of their childhood. That makes "Secret Admirer" from Season 4 the perfect choice here. Everyone has had, or wishes they've had, a secret admirer, and in this episode, every member of the family finds that wish coming true, even though it was true for any of them. It really should be <a href="https://www.cinemablend.com/television/2553472/full-house-best-episodes-ranked">ranked number one</a>. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="icxdpwjGBWtAPX3YbWataM" name="designing women.png" alt="the cast of designing women" src="https://cdn.mos.cms.futurecdn.net/icxdpwjGBWtAPX3YbWataM.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="designing-women-killing-all-the-right-people">Designing Women - Killing All The Right People</h2><p>For whatever reason, <em>Designing Women</em> doesn't seem to have stood the test of time as other sitcoms from the era have. It's odd because in its day, it was wildly popular and a real cultural phenomenon. It was also a show that didn't shy away from commenting on the most controversial issues of the day, as it did in "Killing All The Right People" when it addressed the AIDS epidemic in a time when few were paying as much attention as they should have been. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="So6Dj4wUGnq5GDyHLnnDNG" name="The Jeffersons.jpg" alt="Sherman Hemsley on The Jeffersons" src="https://cdn.mos.cms.futurecdn.net/So6Dj4wUGnq5GDyHLnnDNG.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="the-jeffersons-sorry-wrong-meeting">The Jeffersons - Sorry, Wrong Meeting</h2><p>Few spinoffs in television history have been as popular as <em>The Jeffersons, </em>which was one of the spinoffs from <em>All In The Family</em>. Like the show it came from, <em>The Jeffersons</em> loved to poke fun at series issues, like George accidentally attending a meeting for the KKK in "Sorry, Wrong Meeting." </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="asSvDrGXsJD4YkJQRNRMBo" name="roseannejohngoodman.jpg" alt="John Goodman in Roseanne" src="https://cdn.mos.cms.futurecdn.net/asSvDrGXsJD4YkJQRNRMBo.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="roseanne-war-and-peace">Roseanne - War And Peace</h2><p>"War and Peace," from Season 5 of <em>Roseanne,</em> is all about rumors and family squabbles. That might sound like most episodes of the sitcom, but this one is actually one of the best, as is evident by its ranking at the top. It's a classic Dan episode, which, if we're honest, is the best kind of episode. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="9XwZxoAGCFthCGUfUzKqcS" name="Futurama the Planet Express crew looks up in horror.jpg" alt="The Planet Express gang looking up in horror in Futurama." src="https://cdn.mos.cms.futurecdn.net/9XwZxoAGCFthCGUfUzKqcS.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: 20th Century Animation)</span></figcaption></figure><h2 id="futurama-jurassic-bark">Futurama - Jurassic Bark</h2><p>Any show as beloved as <em>Futurama</em> is going to have a lot of opinions about the best episode. Season 3's "Jurassic Bark" is surprisingly agreed upon by many, though. It's one of the rare times the show got somewhat serious, and that always bumps a show up, it seems. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="oojisrD52duUZmmdnSEcGj" name="gary-coleman-diffrent-strokes-what-chu-talkin-bout-willis (1).jpg" alt="Gary Coleman in Diff'rent Strokes." src="https://cdn.mos.cms.futurecdn.net/oojisrD52duUZmmdnSEcGj.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC/ABC)</span></figcaption></figure><h2 id="diff-rent-strokes-first-love">Diff'rent Strokes -  First Love</h2><p>We have to admit, this one surprised us. <em>Diff'rent Strokes</em> had its fair share of episodes that tackled <a href="https://www.cinemablend.com/television/culturally-controversial-episodes-classic-sitcoms">controversial subjects</a>, but this episode, "First Love," is a pretty straightforward sitcom episode centered around Willis and his new girlfriend, Charlene. Willis isn't allowed to see her, but he finds a way anyway, much to Mr. Drummond's ire. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="KGJdpMmfaWC6xFa3FELkNN" name="murphy brown.png" alt="candice bergen on murphy brown" src="https://cdn.mos.cms.futurecdn.net/KGJdpMmfaWC6xFa3FELkNN.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="murphy-brown-frank-s-appendectomy">Murphy Brown - Frank's Appendectomy</h2><p>Putting this list together, it seemed certain that the most popular episode of <em>Murphy Brown </em>would be "You Say Potatoe, I Say Potato" about Murphy raising her child as a single mother. Instead, a relatively normal, but very funny episode from Season 2, "Frank's Appendectomy," won out. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="NAVHFbgYnQmxg6GFJJ5mtg" name="Sanford and Son.jpg" alt="Redd Foxx and Demond Wilson on Sanford and Son" src="https://cdn.mos.cms.futurecdn.net/NAVHFbgYnQmxg6GFJJ5mtg.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="sanford-and-son-a-guest-in-the-yard">Sanford And Son - A Guest In The Yard</h2><p>One of the classic re-occurring bits on <em>Sanford and Son</em> had Fred berating Lamont for being a "big dummy." In the classic episode "A Guest In The Yard," it's pretty much a whole episode of just that. A homeless man tries to scam Fred and Lamont, and they can't figure out how to get rid of him. Lamont wises up, but it's no use; the man still manages to have them get him drunk. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="M2ec6YVUG6PSFt97uZEzG3" name="debramessingericmccormackwillandgrace.jpg" alt="Debra Messing and Eric McCormack on Will & Grace" src="https://cdn.mos.cms.futurecdn.net/M2ec6YVUG6PSFt97uZEzG3.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="will-grace-grandpa-jack">Will & Grace - Grandpa Jack</h2><p>Jack McFarland on <em>Will & Grace</em> is one of the best supporting characters in sitcom history, and many of the shows that focus on him are among the best in the show's history. Grandpa Jack...wait, Jack is a grandpa?... is no exception, and it's no surprise that it's ranked at the top. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1278px;"><p class="vanilla-image-block" style="padding-top:56.34%;"><img id="MofgC3DuPB8UxvJEEW4A46" name="frasier-reboot.jpg" alt="Kelsey Grammer as Frasier Crane" src="https://cdn.mos.cms.futurecdn.net/MofgC3DuPB8UxvJEEW4A46.jpg" mos="" align="middle" fullscreen="" width="1278" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Paramount)</span></figcaption></figure><h2 id="frasier-ham-radio">Frasier - Ham Radio</h2><p>It's incredible that Kelsey Grammer has been playing Frasier Crane for as many decades as he has. It's one of the most enduring characters in TV history, and "Ham Radio" from the fourth season of <em>Frasier</em> embodies everything we love to hate about the character when he tries to create an old-timey radio drama on his station. Of course, he's controlling and bossy, and everything falls apart...</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="h7W8E3VCcQbbMPHsiYcUT7" name="tbbt cast finale.jpg" alt="Big Bang Theory Cast eating together in final moments of series finale" src="https://cdn.mos.cms.futurecdn.net/h7W8E3VCcQbbMPHsiYcUT7.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO Max)</span></figcaption></figure><h2 id="the-big-bang-theory-the-stockholm-syndrome">The Big Bang Theory · The Stockholm Syndrome</h2><p>The series finale of <em>The Big Bang Theory</em>, called  "The Stockholm Syndrome," is, in a lot of ways, just another episode of the popular show. The gang of nerds gets into trouble on a flight to Sweden. But it definitely feels like a finale in many ways, most notably with the revelation that Penny is pregnant. The show's enduring popularity has <a href="https://www.cinemablend.com/streaming-news/the-big-bang-theory-spinoff-title-gargantuan-predecessor-max-stuart-bloom">led to multiple spinoffs</a>, but the original is still the best for episodes like this. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="4BkV8a2LdqWJHLd5BirYQT" name="richardmolljohnlarroquettenightcourt.jpg" alt="Richard Moll and John Larroquette on Night Court" src="https://cdn.mos.cms.futurecdn.net/4BkV8a2LdqWJHLd5BirYQT.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="night-court-a-day-in-the-life">Night Court - A Day In The Life</h2><p>There is no question that "A Day In The Life" from Season 4 of <em>Night Court</em> is the best episode. The courtroom gang has to work at warp speed to get through hundreds of cases before midnight, and the frantic pace of the episode is hilarious and wonderful. </p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ Full House's Jodie Sweetin And Andrea Barber Address 'Weird Question' They're Often Asked About Co-Star John Stamos, And It Sounds Like Fans Think the Tanners Are The Brady Bunch ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/full-house-jodie-sweetin-andrea-barber-address-weird-question-theyre-often-asked-john-stamos-fans-think-tanners-the-brady-bunch</link>
                                                                            <description>
                            <![CDATA[ Here’s the story of three lovely ladies … ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">8vnuzhdUXFb7cRrPxk82Hf</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/sPXWXon275TDrqDxE3R5t9-1280-80.png" type="image/png" length="0"></enclosure>
                                                                        <pubDate>Sun, 27 Apr 2025 23:15:00 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Heidi Venable ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/w7HQ9MvRSDd7diNpTmruW9.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Heidi Venable is a Content Producer for CinemaBlend. She started freelancing for the site in 2020 and officially came on board in 2021. Her job entails writing news stories and TV reactions from some of her favorite prime-time shows like Grey&#039;s Anatomy and The Bachelor. She graduated from Louisiana Tech University with a degree in Journalism and worked in the newspaper industry for almost two decades in multiple roles including Sports Editor, Page Designer and Online Editor.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Into&lt;/strong&gt;: Heidi grew up in the 1990s, and her tastes strongly reflect that. She can (and does) quote Friends constantly, enjoys a good West Wing binge, thinks Can&#039;t Hardly Wait was the most influential movie of her life and finds solace in 311 concerts. On Sundays during football season, she can be found cheering on the New Orleans Saints with her husband and two daughters. Who Dat! She loves to read but usually settles for a pop culture podcast, and thinks the best weekends are spent cooking and playing cards with friends and family, preferably with some UFC fights or other sporting event on TV.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Excited About Right Now&lt;/strong&gt;: Football season, Pumpkin Spice Lattes and everything related to fall and cooler weather. The Game of Roses podcast and all things The Bachelor, and new episodes of Grey&#039;s Anatomy, Love Is Blind, The Voice, OMITB and more.&amp;nbsp;&lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/png" url="https://cdn.mos.cms.futurecdn.net/sPXWXon275TDrqDxE3R5t9-1280-80.png">
                                                            <media:credit><![CDATA[ABC]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[stephanie tanner and uncle jesse on full house]]></media:description>                                                            <media:text><![CDATA[stephanie tanner and uncle jesse on full house]]></media:text>
                                <media:title type="plain"><![CDATA[stephanie tanner and uncle jesse on full house]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/sPXWXon275TDrqDxE3R5t9-1280-80.png" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>It’s amazing that 40 years after initially meeting on <em>Full House </em>— and some even continuing to appear on the <a href="https://www.cinemablend.com/television/2025-tv-premiere-date-schedule-upcoming-new-returning-shows">2025 TV schedule</a> — the cast members remain so close. This is especially true given the actors’ wide age range and <a href="https://www.cinemablend.com/television/candace-cameron-bure-bob-saget-unlikely-friendship-how-song-reminded-her-full-house-star">differing comedic sensibilities</a>. However, Jodie Sweetin and Andrea Barber got real about a “weird question” they get from fans about just how close they were to their co-stars, and it sounds like people are confusing the Tanners with <em>The Brady Bunch</em>.</p><h2 id="full-house-vets-reveal-a-question-they-get-about-john-stamos">Full House Vets Reveal A Question They Get About John Stamos</h2><p>John Stamos may have played heartthrob Jesse Katsopolis on <em>Full House</em> (streaming with a <a href="https://www.cinemablend.com/television/2570432/subscribing-to-hbo-max-what-to-know-about-the-price-options-and-what-the-streaming-service-offers">Max subscription</a>) and the spinoff <em>Fuller House</em> (streaming with a <a href="https://www.cinemablend.com/streaming-news/netflix-subscription-the-plans-the-price-and-whats-included">Netflix subscription</a>), but to the young ladies on the show, he was simply Uncle Jesse. That familial dynamic, however, hasn’t kept minds from wondering, and Andrea Barber (aka Kimmy Gibler) addressed that on the <a href="https://open.spotify.com/episode/6iQZLLyGQv3aEkVxr18NVn"><em>How Rude, Tannerinos!</em> podcast</a>, saying:  </p><div><blockquote><p>I think it's like when people ask us in media interviews, they're like, did you ever have a crush on John Stamos? No, that is a gross question. They're like our older brothers, and we do not think of them that way.</p></blockquote></div><p>It’s not even the family thing that is the most disturbing about this question, but the fact that Jodie Sweetin was 5 years old when <em>Full House</em> started (13 by the finale). Mary-Kate and Ashley Olsen, meanwhile, were 6 months old — <a href="https://www.cinemablend.com/streaming-news/full-houses-jodie-sweetin-shared-the-best-reasoning-for-why-the-olsen-twins-didnt-return-for-netflixs-fuller-house">8 years old when it ended</a>. </p><p>Even Candace Cameron Bure and Andrea Barber, who were slightly older at 11, were probably a little young to be developing a crush on someone more than 10 years older than them (at least in the earlier seasons). Jodie Sweetin jumped in, adding to what her co-host said:</p><div><blockquote><p>Not even older brothers. They’re like uncles. </p></blockquote></div><p>Technically Jesse wasn’t an uncle to Kimmy, but the dynamic was still there, and Andrea Barber shut down any speculation to the contrary, saying:</p><div><blockquote><p>There's nothing remotely attractive about this. They’re just our buddies. And yeah, this is kind of a weird question.</p></blockquote></div><p>The thing is, not all TV casts have been known to keep things 100% platonic. Yeah, I’m talking about you, Brady kids.</p><h2 id="barry-williams-confirmed-all-the-brady-bunch-kids-hooked-up">Barry Williams Confirmed All The Brady Bunch Kids "Hooked Up"</h2><p>They may have played step-siblings on <em>The Brady Bunch</em> from 1969 to 1974, but those fraternal relationships didn’t stay chaste off the screen. In celebrating the sitcom’s 55th anniversary last year, Barry Williams told <a href="https://www.usmagazine.com/celebrity-news/news/barry-williams-says-brady-bunch-cast-all-hooked-up-with-each-other/">US Weekly</a>:</p><div><blockquote><p>We all hooked up with each other at some point. Not necessarily while we were filming. I dated Maureen [McCormick], and Chris [Knight] dated Eve [Plum] and Michael [Lookinland] and Susan [Olsen] had a little mock wedding at one point. So, yes, we all hooked up.</p></blockquote></div><p>Sounds like there was a lot going on <a href="https://www.cinemablend.com/television/2468481/the-brady-bunch-behind-the-scenes-facts-that-explain-a-lot-about-americas-most-popular-tv-family">behind the scenes of <em>The Brady Bunch</em></a> and in the years that followed. It’s funny that the love connections happened between the actors who played the two oldest stepsiblings (Greg and Marsha), the middle children (Peter and Jan) and the youngest two (<a href="https://www.cinemablend.com/television/annoying-tv-siblings-still-mad-at">annoying TV siblings</a> Bobby and Cindy). </p><p>Much to Jodie Sweetin and Andrea Barber’s chagrin, I’m sure, that’s not where the romantic interests stopped. Despite these <a href="https://www.cinemablend.com/television/the-brady-bunch-affair-rumor-that-still-drives-susan-olsen-bonkers"><em>Brady Bunch</em> rumors driving Susan Olsen nuts</a>, Barry Williams said he did have a crush — if not an affair — with his TV mom Florence Henderson. In the actor’s words:</p><div><blockquote><p>I had a teenage crush on her, for sure, And she’s got a very lively personality and great sense of humor, but I knew that I wanted to have music in my career [in] acting, and so I talked to her a lot about that. I had found this singer coming into the Copacabana near Beverly Hills. I can’t think of exactly where it was, but I invited her to go together as a date, and she said, ‘OK,’ so I was thrilled. And now for me, it was a date.</p></blockquote></div><p>Was there a kiss at the end of that date?</p><div><blockquote><p>I did go in for a little kiss and and, and she was nice enough to return it. So it was a highlight. Nice little peck, yes.</p></blockquote></div><p>At least in the case of <em>The Brady Bunch</em>, all of the hookups seemed to be age appropriate (I’m giving Florence Henderson the benefit of the doubt that the Barry Williams affair was one-sided), so it somehow feels less skeezy than any <em>Full House</em> crushes might have. If you want to see what kind of chemistry the Brady blended family had going on, you can watch old episodes with your <a href="https://www.cinemablend.com/television/2562226/paramount-plus-release-date-price-and-other-things-we-know-about-the-streaming-service">Paramount+ subscription</a>.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ Candace Cameron Bure And Dave Coulier Had A Wholesome Exchange After He Announced He's Cancer Free, But I Didn't See The 'Poopoo' Nickname Coming ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/candace-cameron-bure-dave-coulier-wholesome-exchange-after-announced-cancer-free-poopoo-nickname</link>
                                                                            <description>
                            <![CDATA[ To be a fly on the wall when that nickname first came up. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">ugPF7tr8VzvBAaZz6qMTRb</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/gEMe5ckjD6arRYpu8yjku6-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Tue, 01 Apr 2025 16:32:24 +0000</pubDate>                                                                                                                                <updated>Tue, 01 Apr 2025 17:22:34 +0000</updated>
                                                                                                                                            <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Megan Behnke ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/FBUR6A5F9FTHQpVfjSuYpL.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Megan Behnke has been a Freelance TV News Writer at CinemaBlend since 2021. She has worked at multiple entertainment outlets, including as a Writer and Editor at Nerds and Beyond, TV and Movie News Writer at CBR, and a Freelance Writer at TV Fanatic, writing about topics she&#039;s passionate about like pop culture. She graduated from the University of Wisconsin Oshkosh with a degree in Multimedia Journalism in 2020, writing for the school’s newspaper during her time there. Her expertise in entertainment is mainly in television, but she has written about movies, music, and local events as well.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What They&#039;re Into&lt;/strong&gt;: Megan specializes in television writing, particularly procedurals. 9-1-1 and the Chicago Franchise are currently her favorites, where she can be found obsessively watching the latest episode or coming up with theories. She also loves to listen to music, with Taylor Swift being on the top of her playlist. She isn’t a huge sports person but will occasionally root for the Green Bay Packers, Milwaukee Brewers, and Wisconsin Badgers. As for movies, it’s hard to pick a favorite, but the Marvel Cinematic Universe reigns as her favorite franchise. She used to be a book nerd in grade school, with her favorite genre being fantasy or YA. Her favorite snack is sour cream and onion Pringles, while pizza is her all-time favorite food.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What They&#039;re Excited About Right Now&lt;/strong&gt;: Manifest Season 4 finally coming to Netflix, One Chicago, and Taylor Swift’s upcoming Midnights album, which will be on repeat.&lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/gEMe5ckjD6arRYpu8yjku6-1280-80.jpg">
                                                            <media:credit><![CDATA[Netflix]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Screenshot of DJ and Joey talking in Fuller House.]]></media:description>                                                            <media:text><![CDATA[Screenshot of DJ and Joey talking in Fuller House.]]></media:text>
                                <media:title type="plain"><![CDATA[Screenshot of DJ and Joey talking in Fuller House.]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/gEMe5ckjD6arRYpu8yjku6-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>Following <a href="https://www.cinemablend.com/television/see-john-stamos-candace-cameron-bure-lovely-messages-full-house-co-star-dave-coulier-cancer-battle">Dave Coulier’s cancer diagnosis</a>, the <em>Full House </em>actor has been putting up quite the fight, and he’s been able to do so alongside much support from his family and former co-stars, many of whom are certainly still like family. Among those showing support is Candace Cameron Bure, who previously <a href="https://www.cinemablend.com/television/candace-cameron-bure-opened-up-about-dave-coulier-cancer-diagnosis">opened up about the diagnosis</a> and how “devastating” it was when Coulier called and told her. Months later, Bure is now celebrating the fact that Coulier is officially cancer-free, and the two had a wholesome exchange that also included a “poopoo” nickname.</p><p>Bure took to <a href="https://www.instagram.com/p/DH4HIEyh1cQ">Instagram</a> on Monday to cheer on the news that Coulier is now cancer-free after being previously diagnosed with Stage 3 non-Hodgkin lymphoma in October. The GAF actress and producer shared some sweet photos of herself and Coulier from over the years, including from their <em>Full House </em>days, and totally kept it clean. </p><div class="instagram-embed"><blockquote class="instagram-media"  data-instgrm-version="6" style="width:99.375%; width:-webkit-calc(100% - 2px); width:calc(100% - 2px);"><p><a href="https://www.instagram.com/p/DH4HIEyh1cQ/" target="_blank">A post shared by Candace Cameron Bure (@candacecbure)</a></p><p>A photo posted by  on </p></blockquote></div><p>Of course, the comments were filled with a lot of love. Coulier also went into the comments to express his love for Bure and called her a pretty interesting nickname, and now I’m dying to know where it came from:</p><p>Dave Coulier: Love you so much, poopoo❤️</p><p>Candace Cameron Bure: @dcoulier love YOU so much ❤️</p><p>It’s a very wholesome exchange, especially since it’s clear there’s some type of inside joke or something that includes the “poopoo” nickname. It also shows just how close they are as Bure just expressed her love for Coulier back and didn’t bat an eye. The fact that they have their own little nicknames for each other makes their relationship that much more special, even over 35 years after <em>Full House </em>first aired.</p><p>Bure, who <a href="https://www.cinemablend.com/television/candace-cameron-bure-opens-up-how-bob-saget-impacted-decision-join-the-masked-singer">honored late co-star Bob Saget on <em>The Masked Singer</em></a>, was one of many to show support for Coulier on social media when he made the cancer announcement. Meanwhile, John Stamos wore a bald cap for his longtime friend and after <a href="https://www.cinemablend.com/television/people-complained-john-stamos-wore-bald-cap-in-support-of-full-house-co-star-and-dave-coulier-response">people complained about it just being a bald cap</a>, Coulier came to his defense and shared that he “laughed out loud” when he saw Stamos in it. <a href="https://www.cinemablend.com/television/john-stamos-sweet-new-years-message-shouted-full-house-co-star-cancer-battle-candace-cameron-bure-dave-coulier">Stamos also gave a New Year’s shoutout to Coulier</a>, which was sweet to see.</p><p>Coulier’s cancer battle had not been easy, but he’d been constantly giving fans updates on social media and showing them that he was still putting up a fight. He recently opened up about <a href="https://www.cinemablend.com/television/as-dave-coulier-contends-with-cancer-diagnosis-he-opens-up-missing-late-full-house-co-star-bob-saget">missing Saget</a> and shared what he thought he would say about the diagnosis and how he would be there for him. </p><p>As a longtime <em>Full House </em>fan, I love nothing more than to see the cast interact with each other and reunite with one another. As well as keeping the memory of their late co-star alive. Now that Coulier is officially cancer-free, fans can breathe a sigh of relief knowing that he’s going to be okay. Additionally, there will likely be many more wholesome exchanges and reunions to come as the <em>Full House </em>family celebrates the good news.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ ‘He Comes To Me In My Dreams’: As Dave Coulier Contends With Cancer Diagnosis, He Opens Up About Missing Late Full House Co-Star Bob Saget ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/as-dave-coulier-contends-with-cancer-diagnosis-he-opens-up-missing-late-full-house-co-star-bob-saget</link>
                                                                            <description>
                            <![CDATA[ Mr. Coulier's battle with Stage 3 non-Hodgkin's lymphoma has inspired some specific feelings. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">MKMgbkiiyvLwkrEMZGzkLc</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/Qu9zdCcg5PLjwiLji3G4Ao-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Mon, 31 Mar 2025 21:47:09 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Mike Reyes ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/fmM5xsfuCSo8rQBwh2pcX.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Mike Reyes is the Senior Movie Contributor at CinemaBlend, though that title’s more of a guideline really. Passionate about entertainment since grade school, the movies have always held a special place in his life, which explains his current occupation. Writing in some way, shape, or form since fifth grade, Mike’s time at CinemaBlend started in 2014, when he was hired as a freelance writer. In 2019, Mr. Reyes became a full time fixture of the CB staff, a decision that the management still hotly debates to this very day, questioning whether it was “a good idea, or the best idea?” Mike graduated from Drew University with a Bachelor’s Degree in Political Science, but swore off of running for public office a long time ago. You can hear him on various podcasts, you just need to know where to look.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Into&lt;/strong&gt;: This is a tough question to answer, as Mike’s kind of into a lot of things. Most prominently, he is CinemaBlend’s James Bond expert, thanks to being raised with a healthy appreciation for the storied spy series and anything espionage related. Mike has several other specialized fields that he’s been passionate about since his early years. Among those interests are breaking down the ins and outs of time travel, studying and admiring Large Scale Aggressors, Titans, Kaiju, and dinosaurs; as well as detective work. Adjacent to his entertainment interests, Mr. Reyes enjoys the worlds of high end mens fashion (eyewear included), fine alcohol and cocktails, and the comforts of a good book or video game. If you ask nicely, he might even dip back into his experience as a singer, just for fun.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Excited About Right Now&lt;/strong&gt;: The continuing hunt for the new James Bond, any and all updates about how Adam Wingard and Dan Stevens are turning Godzilla vs. Kong 2 into a stealth sequel to The Guest, and the potential for Tron: Ares to somehow be the sequel Tron: Ascension was promised to be. Also, a good excuse to be sent on another theme park assignment, and anything Guillermo del Toro has cooking,&lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/Qu9zdCcg5PLjwiLji3G4Ao-1280-80.jpg">
                                                            <media:credit><![CDATA[Netflix]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Danny and Joey sitting at kitchen table in Fuller House series finale]]></media:description>                                                            <media:text><![CDATA[Danny and Joey sitting at kitchen table in Fuller House series finale]]></media:text>
                                <media:title type="plain"><![CDATA[Danny and Joey sitting at kitchen table in Fuller House series finale]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/Qu9zdCcg5PLjwiLji3G4Ao-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>Three years after Bob Saget’s passing, the <a href="https://www.cinemablend.com/television/2025-tv-premiere-date-schedule-upcoming-new-returning-shows"><u>2025 TV schedule</u></a><strong> </strong>sees members of the <a href="https://www.cinemablend.com/television/full-house-dave-coulier-how-cast-preserves-bob-saget-memory"><u><em>Full House</em></u><u> cast preserving Bob Saget’s memory</u></a> through their work and their memories. Co-star Dave Coulier knew the late comedian well going back to the '80s, which makes his recent discussion of Saget’s legacy in the context of his own health even more poignant.</p><p>As <a href="https://www.cinemablend.com/television/see-john-stamos-candace-cameron-bure-lovely-messages-full-house-co-star-dave-coulier-cancer-battle"><u>Coulier’s ongoing cancer battle</u></a> has seen him undergo multiple rounds of chemotherapy, fond remembrances of Tanner family’s TV patriarch were brought up in conversation with <a href="https://parade.com/celebrities/dave-coulier-cancer-interview-exclusive"><u>Parade Magazine</u></a>. The comedy legend and former host of <em>America’s Funniest People</em> very much misses his friend, who was a third of <em>Full House</em>'s main trio of adults along with Coulier himself and John Stamos. </p><p>In such a time of personal challenges, Dave Coulier has all of the love in the world from his friends. As he describes below, the memory of Bob Saget also affects him:</p><div><blockquote><p>I miss Bob so much. I truly had a brother [in him]. I met Bob when I was 18 years old. And by the way, yes, he comes to me in my dreams, and he always does something silly and foolish and makes me laugh. He would have called me every day. … [Mimics Saget] How are you doing? What's the prognosis, Dave? Tell me what's going on. He would have driven me crazy. It was a lovable crazy that he had. I think about him often.</p></blockquote></div><p>While <em>Full House</em> legends like Candace Cameron Bure also feel Bob Saget’s influence, Mr. Coulier’s connection to his chosen brother goes back quite a long way. One would assume that means that <a href="https://www.cinemablend.com/television/full-house-star-bob-saget-is-dead-at-65"><u>Saget’s untimely death</u></a> during a tour hit Coulier particularly hard even before his diagnosis with non-Hodgkin's lymphoma.</p><p>Similarly, <a href="https://www.cinemablend.com/television/people-complained-john-stamos-wore-bald-cap-in-support-of-full-house-co-star-and-dave-coulier-response"><u>Dave Coulier and John Stamos’ </u><u><em>Full House</em></u><u> brotherhood</u></a> looks to have that same sort of “lovable crazy” energy. Otherwise, why would Stamos have pulled that good natured bald cap stunt when Coulier started rocking that look for real? </p><p>But even knowing full well that Bob Saget is no longer living, the voice acting alum of such cartoons as <em>Muppet Babies</em> and <em>The Real Ghostbusters</em> still feels his friend’s presence quite strongly. Coulier went on:</p><div><blockquote><p>I'll be having a moment of clarity, and I'll think, ‘Oh, call Bob,’ and then I realize I can't. And then I realize I can't call anybody and tell them this thought that I have right now because Bob is the only one who would think so outrageously to be able to respond to it.</p></blockquote></div><p>As Dave Coulier has concluded his chemotherapy treatments, he’ll continue to move forward. But to go back to his previous comments about “filling that well” known as the legacy of Bob Saget, his fond remembrance of his longtime friend is just as important as all of the <a href="https://www.cinemablend.com/television/as-full-house-fan-im-in-my-feels-bob-saget-john-stamos-and-more-throwback-party-photos"><u><em>Full House</em></u><u> memories</u></a> shared by the rest of the cast. </p><p>We here at CinemaBlend continue to extend our well wishes to Mr. Coulier, his friends, and his family on his journey to better health. May the next update be one with better results, and an even greater prognosis. </p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ ‘What Is This Crazy Show?’ Candace Cameron Bure Opens Up About How Late Co-Star Bob Saget Impacted Her Decision To Join The Masked Singer ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/candace-cameron-bure-opens-up-how-bob-saget-impacted-decision-join-the-masked-singer</link>
                                                                            <description>
                            <![CDATA[ A lovely tribute. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">97JZ3y8uS9xxBH9qizCp56</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/S9D5xx9tbNhc8eFxDKbLwg-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Sun, 30 Mar 2025 18:12:21 +0000</pubDate>                                                                                                                                <updated>Sun, 30 Mar 2025 22:35:39 +0000</updated>
                                                                                                                                            <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Heidi Venable ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/w7HQ9MvRSDd7diNpTmruW9.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Heidi Venable is a Content Producer for CinemaBlend. She started freelancing for the site in 2020 and officially came on board in 2021. Her job entails writing news stories and TV reactions from some of her favorite prime-time shows like Grey&#039;s Anatomy and The Bachelor. She graduated from Louisiana Tech University with a degree in Journalism and worked in the newspaper industry for almost two decades in multiple roles including Sports Editor, Page Designer and Online Editor.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Into&lt;/strong&gt;: Heidi grew up in the 1990s, and her tastes strongly reflect that. She can (and does) quote Friends constantly, enjoys a good West Wing binge, thinks Can&#039;t Hardly Wait was the most influential movie of her life and finds solace in 311 concerts. On Sundays during football season, she can be found cheering on the New Orleans Saints with her husband and two daughters. Who Dat! She loves to read but usually settles for a pop culture podcast, and thinks the best weekends are spent cooking and playing cards with friends and family, preferably with some UFC fights or other sporting event on TV.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Excited About Right Now&lt;/strong&gt;: Football season, Pumpkin Spice Lattes and everything related to fall and cooler weather. The Game of Roses podcast and all things The Bachelor, and new episodes of Grey&#039;s Anatomy, Love Is Blind, The Voice, OMITB and more.&amp;nbsp;&lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/S9D5xx9tbNhc8eFxDKbLwg-1280-80.jpg">
                                                            <media:credit><![CDATA[Fox]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Candace Cameron Bure on The Masked Singer.]]></media:description>                                                            <media:text><![CDATA[Candace Cameron Bure on The Masked Singer.]]></media:text>
                                <media:title type="plain"><![CDATA[Candace Cameron Bure on The Masked Singer.]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/S9D5xx9tbNhc8eFxDKbLwg-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>Since <a href="https://www.cinemablend.com/television/full-house-star-bob-saget-is-dead-at-65">Bob Saget’s sudden death</a> in 2022, The <em>Full House</em> cast has kept his memory alive through <a href="https://www.cinemablend.com/television/as-full-house-fan-im-in-my-feels-bob-saget-john-stamos-and-more-throwback-party-photos">throwback party photos</a> and endless stories about him and his <a href="https://www.cinemablend.com/television/candace-cameron-bure-made-the-best-bob-saget-shirt-and-wore-it-to-reminisce-with-uncle-joey">penchant for hugging</a>, but he also inspired Cameron Candace Bure in a possibly unexpected way. Bure was recently unveiled as Cherry Blossom on <em>The Masked Singer</em>’s 13th season (airing on the <a href="https://www.cinemablend.com/television/2025-tv-premiere-date-schedule-upcoming-new-returning-shows">2025 TV schedule</a> and streaming with a <a href="https://www.cinemablend.com/television/full-house-star-bob-saget-is-dead-at-65">Hulu subscription</a>), and she opened up about how Saget impacted her decision to do the show.</p><p>Candace Cameron Bure played DJ, the oldest daughter of Danny Tanner (Bob Saget) on <em>Full House</em> and later on the spinoff, <em>Fuller House</em>. While <a href="https://www.cinemablend.com/streaming-news/people-always-ask-fuller-houses-candace-cameron-bure-how-she-and-bob-saget-could-be-friends-given-his-stand-up-she-explains">Saget’s raunchy standup would seemingly conflict</a> with Bure’s more conservative sensibilities, the two were undeniably close, and she said on the <a href="https://www.iheart.com/podcast/1119-whine-down-with-jana-kram-29262403/episode/unmask-and-unwhine-the-cherry-blossom-271089893/"><em>Whine Down with Jana Kramer</em> podcast</a> that she wanted to honor her former co-star. Bure told host Jana Kramer:</p><div><blockquote><p>I’m so terrified of singing in front of people, so I’ve said no. This is the fourth time they’ve asked me. And I finally was like, ‘You know what? I’m just gonna do it. I’ll get over the fear.’ And then, when I really started thinking about it, Bob was such a special part of the show, and he was in the first episode that I ever watched, not knowing it was him. </p></blockquote></div><p><a href="https://www.cinemablend.com/television/2558312/the-masked-singers-squiggly-monster-revealed-big-plans-for-the-next-round">Bob Saget was revealed to be the Squiggly Monster</a> on <em>The Masked Singer</em> in Season 4, which apparently another <em>Full House</em> alum, John Stamos, had been aware of because the Uncle Jesse portrayer would have appeared as a clue if Saget had made it further. </p><p>Candace Cameron Bure, meanwhile, wasn’t informed beforehand that her former TV dad would be one of the costumed contestants, but it didn’t take her long to figure it out. She continued:</p><div><blockquote><p>But I'm sitting on my couch and I'm like, 'What is this crazy show?' People are walking out in these costumes. It was so nuts to me. And I go, ‘I’m just gonna watch one episode.’ And, as soon as the Squiggly Eyed Monster walked out, I heard one note, and I was like, ‘That’s Bob! That’s Bob!’ I was, like, jumping on my couch like Tom Cruise with Katie Holmes. I was like, 'That's Bob! This is amazing!' And I kinda just — I loved it from then on out because he was the introduction for me to the show.</p></blockquote></div><p>What a fun memory, and I can see how channeling his energy could be motivation to finally accept <em>The Masked Singer</em>’s invitation, despite being so scared to do it.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="pvEHnQqBA88ezgRHdnpwwg" name="ccb bob masked singer" alt="Candace Cameron Bure and Bob Saget on their respective seasons of The Masked Singer." src="https://cdn.mos.cms.futurecdn.net/pvEHnQqBA88ezgRHdnpwwg.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><p>Jana Kramer — who, like Candace Cameron Bure, has done both <em>The Masked Singer</em> and <em>Dancing with the Stars</em> — said the mask provided a shield between her and the audience that made her more comfortable singing. That was a key difference-maker for Bure compared to ABC’s celebrity dance competition. </p><div class="product"><a data-dimension112="14a7b2c2-0753-4c07-a5ce-bc93ffc631af" data-action="Deal Block" data-label="Hulu: 30-Day Free Trial" data-dimension48="Hulu: 30-Day Free Trial" href="http://click.linksynergy.com/fs-bin/click?id=kXQk6%2aivFEQ&offerid=1589248.1591&type=3&subid=0&u1=hawk-custom-tracking" target="_blank" rel="nofollow"><figure class="van-image-figure "  ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1414px;"><p class="vanilla-image-block" style="padding-top:99.29%;"><img id="bhyqudLBfMw7KeCkdxjRBL" name="Hulu logo.png" caption="" alt="" src="https://cdn.mos.cms.futurecdn.net/bhyqudLBfMw7KeCkdxjRBL.png" mos="" align="middle" fullscreen="" width="1414" height="1404" attribution="" endorsement="" credit="" class=""></p></div></div></figure></a><p><a href="https://click.linksynergy.com/fs-bin/click?id=kXQk6%2aivFEQ&offerid=1589248.1591&type=3&subid=0&u1=hawk-custom-tracking" target="_blank" rel="nofollow" data-dimension112="14a7b2c2-0753-4c07-a5ce-bc93ffc631af" data-action="Deal Block" data-label="Hulu: 30-Day Free Trial" data-dimension48="Hulu: 30-Day Free Trial" data-dimension25=""><strong>Hulu: 30-Day Free Trial</strong></a><strong><br></strong>Take in all the amazing tunes and celebrity reveals of The Masked Singer by subscribing to Hulu! The streamer's Ad-Supported and Ad-Free tiers give subscribers access to everything the platform offers. Also, be aware that new and eligible returning customers can have a whole month of the service for free before paying, with plans starting from $9.99 a month.<a class="view-deal button" href="http://click.linksynergy.com/fs-bin/click?id=kXQk6%2aivFEQ&offerid=1589248.1591&type=3&subid=0&u1=hawk-custom-tracking" target="_blank" rel="nofollow" data-dimension112="14a7b2c2-0753-4c07-a5ce-bc93ffc631af" data-action="Deal Block" data-label="Hulu: 30-Day Free Trial" data-dimension48="Hulu: 30-Day Free Trial" data-dimension25="">View Deal</a></p></div><p>The Great American Family star agreed, to a point, saying she had such a fulfilling experience on <em>DWTS</em>, while her early elimination on the Fox series didn’t allow her to fully overcome that fear of singing in front of people.</p><p>I’d like to think that either way, Bob Saget would be proud of her for facing that fear. If you want to revisit some of <a href="https://www.cinemablend.com/television/2553472/full-house-best-episodes-ranked"><em>Full House</em>’s best episodes</a> (or the <a href="https://www.cinemablend.com/television/full-houses-jodie-sweetin-and-andrea-barber-cant-stand-one-of-earliest-episodes">worst episode, according to <em>Full House</em> co-stars</a> Jodie Sweetin and Andrea Barber), the entire series is available to stream with a <a href="https://www.cinemablend.com/television/2570432/subscribing-to-hbo-max-what-to-know-about-the-price-options-and-what-the-streaming-service-offers">Max subscription</a>. <em>The Masked Singer</em> Season 13 continues at 8 p.m. ET Wednesdays on Fox.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ As A Full House Fan, I’m In My Feels Over Seeing Bob Saget, John Stamos And More In Sweet Throwback Party Photos ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/as-full-house-fan-im-in-my-feels-bob-saget-john-stamos-and-more-throwback-party-photos</link>
                                                                            <description>
                            <![CDATA[ Oh Mylanta these are cute! ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">uTXsiu7JrXVCoZRVRDXY7U</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/sPXWXon275TDrqDxE3R5t9-1280-80.png" type="image/png" length="0"></enclosure>
                                                                        <pubDate>Wed, 26 Mar 2025 02:40:57 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Heidi Venable ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/w7HQ9MvRSDd7diNpTmruW9.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Heidi Venable is a Content Producer for CinemaBlend. She started freelancing for the site in 2020 and officially came on board in 2021. Her job entails writing news stories and TV reactions from some of her favorite prime-time shows like Grey&#039;s Anatomy and The Bachelor. She graduated from Louisiana Tech University with a degree in Journalism and worked in the newspaper industry for almost two decades in multiple roles including Sports Editor, Page Designer and Online Editor.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Into&lt;/strong&gt;: Heidi grew up in the 1990s, and her tastes strongly reflect that. She can (and does) quote Friends constantly, enjoys a good West Wing binge, thinks Can&#039;t Hardly Wait was the most influential movie of her life and finds solace in 311 concerts. On Sundays during football season, she can be found cheering on the New Orleans Saints with her husband and two daughters. Who Dat! She loves to read but usually settles for a pop culture podcast, and thinks the best weekends are spent cooking and playing cards with friends and family, preferably with some UFC fights or other sporting event on TV.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Excited About Right Now&lt;/strong&gt;: Football season, Pumpkin Spice Lattes and everything related to fall and cooler weather. The Game of Roses podcast and all things The Bachelor, and new episodes of Grey&#039;s Anatomy, Love Is Blind, The Voice, OMITB and more.&amp;nbsp;&lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/png" url="https://cdn.mos.cms.futurecdn.net/sPXWXon275TDrqDxE3R5t9-1280-80.png">
                                                            <media:credit><![CDATA[ABC]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[stephanie tanner and uncle jesse on full house]]></media:description>                                                            <media:text><![CDATA[stephanie tanner and uncle jesse on full house]]></media:text>
                                <media:title type="plain"><![CDATA[stephanie tanner and uncle jesse on full house]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/sPXWXon275TDrqDxE3R5t9-1280-80.png" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>It’s hard to believe that it’s been nearly 40 years since we first met the Tanner family on ABC’s <em>Full House</em>. Many fans who have come to love the show weren’t even born when it premiered in 1987. The Olsen twins hadn’t even had their 1st birthday yet, and now <a href="https://www.cinemablend.com/television/full-houses-ashley-olsen-gives-birth-first-child-secret-pregnancy">Ashley Olsen is a mom</a>. Candace Cameron Bure has a <a href="https://www.cinemablend.com/television/candace-cameron-bure-celebrates-son-lev-big-wedding-day-gold-dress">son who is married</a>. The passage of time is astounding, so seeing throwback pics from a Season 1 party really has me in my feels.</p><p>This blast of nostalgia comes to us thanks to Jodie Sweetin, who played middle sister Stephanie to CCB’s DJ and the Olsen twins’ Michelle. On the Instagram page of her podcast <em>How Rude, Tanneritos!</em>, which she co-hosts with Andrea Barber (aka Kimmy Gibler), Sweetin shared some <a href="https://www.instagram.com/p/DHl8ZGVSJFu/"><u>pics from the cast’s Season 1 Christmas party</u></a>.</p><p>Honestly, after seeing those photos, could Jodie Sweetin possibly be cuter? The actress would have been 5 years old at Christmas in 1987, and I am loving her adorable sweater. (Anybody else getting <a href="https://www.cinemablend.com/television/whatever-happened-to-full-house-mr-bear-jodie-sweetin-explains-stuffed-toy-today">Mr. Bear vibes</a>?) </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="LHn7ktsmftKahwDd3UiK25" name="stephanie and mr. bear" alt="Jodie Sweetin as Stephanie Tanner holds Mr. Bear on an episode of Full House." src="https://cdn.mos.cms.futurecdn.net/LHn7ktsmftKahwDd3UiK25.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Hulu)</span></figcaption></figure><p>She’s pictured in the Instagram post with Bob Saget, who played her dad Danny on <em>Full House</em> (which can be streamed with a <a href="https://www.cinemablend.com/television/2570432/subscribing-to-hbo-max-what-to-know-about-the-price-options-and-what-the-streaming-service-offers">Max subscription</a>), as well as John Stamos (better known as Uncle Jesse) and Dave Coulier (who I have admittedly <a href="https://www.cinemablend.com/television/jodie-sweetin-clarified-common-full-house-misconception-mind-blown">called “Uncle Joey,” despite him not being related</a>). Saget looks like a baby himself in that flashback to the ‘80s, and that’s another tough thing to come to terms with regarding time, seeing as it’s been three years since we <a href="https://www.cinemablend.com/movies/stand-up-comedians-who-passed-way-too-soon">lost the standup comedian way too soon</a>. </p><p><a href="https://www.cinemablend.com/television/full-house-star-bob-saget-is-dead-at-65">Bob Saget died</a> in January 2022 after suffering what was <a href="https://www.cinemablend.com/television/bob-sagets-cause-of-death-determined-to-be-head-trauma">determined to be a head trauma</a> following a show in Florida. His <a href="https://www.cinemablend.com/television/full-house-dave-coulier-how-cast-preserves-bob-saget-memory"><em>Full House</em> family has continued to “fill the well,”</a> so to speak, and preserve his memory by sharing stories of their good times together.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="39pQkaQJFuHx2PQChYWfCe" name="Candace-Cameron-Bure-candace-cameron-bure-bob-saget-tribute085_.jpg" alt="Bob Saget and Candace Cameron Bure on Full House" src="https://cdn.mos.cms.futurecdn.net/39pQkaQJFuHx2PQChYWfCe.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros. Television)</span></figcaption></figure><p>On the post, I also love seeing how close John Stamos clearly was with Jodie Sweetin. Stamos seems to have had a prickly relationship with his co-stars in the beginning. He <a href="https://www.cinemablend.com/television/Full-House-John-Stamos-Almost-Got-Olsen-Twins-Fired-76727.html">got the Olsen twins temporarily fired</a>, he <a href="https://www.cinemablend.com/television/john-stamos-pissed-off-bob-saget-during-full-house-days-he-initially-disliked-co-star">“pissed off” Bob Saget</a> and he was <a href="https://www.cinemablend.com/television/john-stamos-nervous-full-houses-future-filming-pilot-olsen-twins-fired">nervous about being upstaged</a> by the cute kiddos.</p><p>But you can’t look at that cute Christmas party pic and think for one second that he wasn’t already smitten with his TV niece. </p><p>It’s always a delight when the <em>Full House</em> cast give us glimpses into the past — even if it does make us feel ancient — and we got plenty of that when the actors celebrated the <a href="https://www.cinemablend.com/television/full-house-cast-celebrates-35th-anniversary-with-lots-of-throwback-pics-and-bob-saget-love">sitcom’s 35th anniversary</a> a couple of years ago. <a href="https://www.cinemablend.com/television/john-stamos-sweet-throwback-olsen-twins-full-house-years-congratulating-ashley-baby">John Stamos also shared a throwback pic</a> of himself with his arms wrapped around both Mary-Kate and Ashley Olsen when they were toddlers.</p><p>Seeing how much these actors always cared for each other reminds us of why we fell in love with <em>Full House</em> in the first place and why it remains one of the <a href="https://www.cinemablend.com/streaming-news/best-shows-streaming-on-max">best series on Max</a> right now. If you need a dose of that Tanner family goodness, check out the <a href="https://www.cinemablend.com/television/2553472/full-house-best-episodes-ranked">best <em>Full House</em> episodes</a>, with all eight seasons available to stream.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ Full House’s Jodie Sweetin And Andrea Barber Can’t Stand One Of The Show’s Earliest Episodes, And I Couldn’t Agree With This Pick More ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/full-houses-jodie-sweetin-and-andrea-barber-cant-stand-one-of-earliest-episodes</link>
                                                                            <description>
                            <![CDATA[ Definitely not my favorite. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">sYTfLY3W4bPUMCZdmsSxfM</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/X7FkXGmqXLMCAFMH4GnxwG-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Tue, 25 Mar 2025 11:00:00 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Heidi Venable ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/w7HQ9MvRSDd7diNpTmruW9.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Heidi Venable is a Content Producer for CinemaBlend. She started freelancing for the site in 2020 and officially came on board in 2021. Her job entails writing news stories and TV reactions from some of her favorite prime-time shows like Grey&#039;s Anatomy and The Bachelor. She graduated from Louisiana Tech University with a degree in Journalism and worked in the newspaper industry for almost two decades in multiple roles including Sports Editor, Page Designer and Online Editor.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Into&lt;/strong&gt;: Heidi grew up in the 1990s, and her tastes strongly reflect that. She can (and does) quote Friends constantly, enjoys a good West Wing binge, thinks Can&#039;t Hardly Wait was the most influential movie of her life and finds solace in 311 concerts. On Sundays during football season, she can be found cheering on the New Orleans Saints with her husband and two daughters. Who Dat! She loves to read but usually settles for a pop culture podcast, and thinks the best weekends are spent cooking and playing cards with friends and family, preferably with some UFC fights or other sporting event on TV.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Excited About Right Now&lt;/strong&gt;: Football season, Pumpkin Spice Lattes and everything related to fall and cooler weather. The Game of Roses podcast and all things The Bachelor, and new episodes of Grey&#039;s Anatomy, Love Is Blind, The Voice, OMITB and more.&amp;nbsp;&lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/X7FkXGmqXLMCAFMH4GnxwG-1280-80.jpg">
                                                            <media:credit><![CDATA[Max]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[John Stamos, Bob Saget and Dave Coulier as Jesse, Danny and Joey on Full House&#039;s Season 1 episode &quot;Sea Cruise.&quot;]]></media:description>                                                            <media:text><![CDATA[John Stamos, Bob Saget and Dave Coulier as Jesse, Danny and Joey on Full House&#039;s Season 1 episode &quot;Sea Cruise.&quot;]]></media:text>
                                <media:title type="plain"><![CDATA[John Stamos, Bob Saget and Dave Coulier as Jesse, Danny and Joey on Full House&#039;s Season 1 episode &quot;Sea Cruise.&quot;]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/X7FkXGmqXLMCAFMH4GnxwG-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p><em>Full House</em> is a much-beloved series in the history of television, with many still enjoying reruns with their <a href="https://www.cinemablend.com/television/2570432/subscribing-to-hbo-max-what-to-know-about-the-price-options-and-what-the-streaming-service-offers">Max subscription</a>. Most of the cast members love to relive those memories as well, especially Jodie Sweetin and Andrea Barber on their <a href="https://www.cinemablend.com/television/jodie-sweetin-dave-coulier-launched-full-house-podcasts-love-fest-bob-saget"><em>Full House</em> rewatch podcast</a>. However, that doesn’t mean they’re afraid to share their true feelings about some of the sitcom’s rougher moments. They recently revealed the one early episode they say is “easily the worst,” and I think they’re spot-on. </p><p>“Sea Cruise,” the fifth episode of <em>Full House</em>’s first season, has been officially dubbed the worst in the eyes of Stephanie Tanner and Kimmy Gibbler portrayers Jodie Sweetin and Andrea Barber. They made their strong opinions known on a recent episode of <a href="https://open.spotify.com/show/0S3M4HuQu8ySvsNy80vu0C"><em>How Rude, Tanneritos!</em></a>, on which Barber declared:</p><div><blockquote><p>[It’s] easily the worst episode. I don't think there's been a worse episode since 'Sea Cruise.' Like, I think 'Sea Cruise' takes the cake for all seasons.</p></blockquote></div><p>On this episode, which originally aired October 16, 1987, Danny (Bob Saget) ships the girls off to grandma’s house so he can enjoy some male bonding time with Jesse (John Stamos) and Joey (Dave Coulier). Despite Danny’s apprehension to move on so soon after his wife’s death, the guys end up on a rickety boat full of women.</p><p>Jodie Sweetin agreed with her podcast co-host, though she threw out a couple of possible competitors in the “worst episode” category, saying:</p><div><blockquote><p>'Sea Cruise' takes the cake. Although, whatever that weird Michelle dream sequence was was also creepy. And the Howie stuff was also pretty low. But, again, not as bad as 'Sea Cruise.'</p></blockquote></div><p>Andrea Barber stood firm, though, saying that in the years they’ve been rewatching all of the Tanner family fun, she hasn’t come across an episode as bad as this one. In her words:</p><div><blockquote><p>Still not as bad as 'Sea Cruise,' yeah. I keep waiting to assign, to crown, a new worst episode, but for me, it's 'Sea Cruise.' It’s still there.</p></blockquote></div><p>I’ve got to say, I agree wholeheartedly with “Sea Cruise” receiving this designation. Maybe I’m a little biased, since I grew up alongside DJ, Stephanie and Michelle, but doesn’t everybody agree <em>Full House</em> is at its best when the girls are around? Even <a href="https://www.cinemablend.com/television/john-stamos-nervous-full-houses-future-filming-pilot-olsen-twins-fired">John Stamos admitted he was nervous</a> early on about getting upstaged by the child actors. </p><p>Five episodes into the series, I have to wonder how many people were tuning in to hear the double entendres and innuendo of the three single guys, not to mention their cringe musical numbers, corny dialogue and Jesse's fragile ego.</p><div class="product"><a data-dimension112="019ddc2f-657c-492a-bd5e-7af7017f2c91" data-action="Deal Block" data-label="Max: Plans start from $9.99 a month" data-dimension48="Max: Plans start from $9.99 a month" href="https://www.max.com/" target="_blank" rel="nofollow"><figure class="van-image-figure "  ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:500px;"><p class="vanilla-image-block" style="padding-top:100.00%;"><img id="emKLzxEYXbt9xUrDPEJPF9" name="Max-logo.jpg" caption="" alt="" src="https://cdn.mos.cms.futurecdn.net/emKLzxEYXbt9xUrDPEJPF9.jpg" mos="" align="middle" fullscreen="" width="500" height="500" attribution="" endorsement="" credit="" class=""></p></div></div></figure></a><p><a href="https://www.max.com/" target="_blank" rel="nofollow" data-dimension112="019ddc2f-657c-492a-bd5e-7af7017f2c91" data-action="Deal Block" data-label="Max: Plans start from $9.99 a month" data-dimension48="Max: Plans start from $9.99 a month" data-dimension25=""><strong>Max: Plans start from $9.99 a month</strong></a><strong><br></strong>Watch every episode of Full House, as well as other classic series like Friends, The Wire, and The Sopranos. Pay from $9.99 a month for its With Ads plan, now with three tiers available to those after a <a href="https://www.cinemablend.com/television/2570432/subscribing-to-hbo-max-what-to-know-about-the-price-options-and-what-the-streaming-service-offers">Max subscription</a>. Prepay for a year and save up 20%.<a class="view-deal button" href="https://www.max.com/" target="_blank" rel="nofollow" data-dimension112="019ddc2f-657c-492a-bd5e-7af7017f2c91" data-action="Deal Block" data-label="Max: Plans start from $9.99 a month" data-dimension48="Max: Plans start from $9.99 a month" data-dimension25="">View Deal</a></p></div><p>I was, however, a little surprised at how easily Andrea Barber and Jodie Sweetin came to their conclusion. Given how <a href="https://www.cinemablend.com/television/full-house-jodie-sweetin-andrea-barber-dj-episode-makes-them-uncomfortable">“uncomfortable” they were watching the DJ episode</a> “Shape Up” from Season 4 — in which Candace Cameron Bure’s character stops eating in hopes of losing weight before Kimmy’s pool party — I thought that might have been in the running. </p><p>Of course, we all have our <a href="https://www.cinemablend.com/television/2553472/full-house-best-episodes-ranked">favorite <em>Full House </em>episodes</a> and our least favorite, and with it being one of the <a href="https://www.cinemablend.com/streaming-news/best-shows-streaming-on-max">best shows to stream on Max</a> right now, you can revisit any of them that you wish.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ 32 Annoying TV Siblings I’m Still Mad At ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/annoying-tv-siblings-still-mad-at</link>
                                                                            <description>
                            <![CDATA[ Making life worse for their families... and viewers. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">TxxAGm37PLHYndZUvJnGVM</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/JbFvBJATCESyPD9k25Y6CA-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Fri, 14 Mar 2025 17:33:00 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Jason Wiese ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/62SRu9Bi2SyJGrpzKXAfsK.jpg ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Jason Wiese writes feature stories for CinemaBlend. His occupation results from years dreaming of a filmmaking career, settling on a &quot;professional film fan&quot; career, studying journalism at Lindenwood University in St. Charles, MO (where he served as Culture Editor for its student-run print and online publications), and a brief stint of reviewing movies for fun. He would later continue that side-hustle of film criticism on TikTok (@wiesewisdom), where he posts videos on a semi-weekly basis.&lt;/p&gt;&lt;p&gt;&lt;br&gt;&lt;/p&gt;&lt;p&gt;Jason has been writing since he was able to pick up a washable marker, with which he wrote his debut illustrated children&#039;s story, later transitioning to a short-lived comic book series and (very) amateur filmmaking before finally settling on pursuing a career in writing about movies in lieu of making them. Look for his name in almost any article about Batman.&lt;/p&gt;&lt;p&gt;&lt;br&gt;&lt;/p&gt;&lt;p&gt;&lt;strong&gt;What He&#039;s Into&lt;/strong&gt;: Readers may notice a recurring theme of horror and superhero-related content (especially in regards to Batman) in much of Jason&#039;s work, but his favorite film of all time is more in line with traditional action/adventure stories: &lt;em&gt;Raiders of the Lost Ark&lt;/em&gt;. His favorite TV series is the gritty, grounded crime thriller &lt;em&gt;Breaking Bad&lt;/em&gt; and if you catching him reading anything, it is probably a comic book (and, more often than not, one featuring Batman). More important to him than entertainment, however, are his wife and two dogs.&lt;/p&gt;&lt;p&gt;&lt;br&gt;&lt;/p&gt;&lt;p&gt;&lt;strong&gt;What He&#039;s Excited About Right Now&lt;/strong&gt;: Jason typically tries to keep his excitement and expectations for any upcoming movies as low as possible, but he is certainly looking forward to returning to Matt Reeves&#039; vision of Gotham City in the upcoming follow-up to &lt;em&gt;The Batman&lt;/em&gt; and just about any horror movie set to haunt cinemas soon.&lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/JbFvBJATCESyPD9k25Y6CA-1280-80.jpg">
                                                            <media:credit><![CDATA[Fox]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Justin Berfield as Reese hiding in bushes on Malcolm in the Middle]]></media:description>                                                            <media:text><![CDATA[Justin Berfield as Reese hiding in bushes on Malcolm in the Middle]]></media:text>
                                <media:title type="plain"><![CDATA[Justin Berfield as Reese hiding in bushes on Malcolm in the Middle]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/JbFvBJATCESyPD9k25Y6CA-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>You know those <a href="https://www.cinemablend.com/television/sitcom-kids-who-were-horribly-misbehaved">ill-behaved sitcom kids</a> and bullish older brothers and sisters from family shows whom you are supposed to find funny? Well, to be perfectly honest, I do not find their irritating quirks very funny and sometimes even dread the moment they will appear on screen and highly anticipate their eventual exit. Here are some examples of the annoying TV siblings I am talking about.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="hqPJ5exwzMGHahgpBZAMm7" name="drakejoshmirandacosgrove.jpg" alt="Miranda Cosgrove in Drake & Josh" src="https://cdn.mos.cms.futurecdn.net/hqPJ5exwzMGHahgpBZAMm7.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Nickelodeon)</span></figcaption></figure><h2 id="megan-parker-drake-josh">Megan Parker (Drake & Josh)</h2><p>In most episodes of Nickelodeon's <em>Drake & Josh</em>, the trouble the titular stepbrothers (played by Drake Bell and Josh Nichols) would regularly get into was of no fault but their own. However, they still faced a great deal of torment at the hands of their younger sister, Megan (Miranda Cosgrove), whose early pranks were adorably mischievous but later proved to be surprisingly sophisticated and even life-threatening, also making her a <a href="https://www.cinemablend.com/movies/movies-tv-shows-with-child-characters-we-would-not-want-to-mess-with">fictional child you should not mess with</a>. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="PcPoL37naoF4gaEjgtgYhB" name="Tiger - The Brady Bunch" alt="Bobby Brady hugging the family dog, Tiger in The Brady Bunch" src="https://cdn.mos.cms.futurecdn.net/PcPoL37naoF4gaEjgtgYhB.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="bobby-brady-the-brady-bunch">Bobby Brady (The Brady Bunch)</h2><p>To be frank, I think each one of the kids from <em>The Brady Bunch</em> has their own annoying characteristics. However, Bobby was a bit of a special case, and not just because he was the youngest boy, but because he would come up with new ways to annoy the others in multiple episodes.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="LAtgwuzaFLpZheAj6zMxJJ" name="trinavictorious.jpg" alt="Daniella Monet in Victorious" src="https://cdn.mos.cms.futurecdn.net/LAtgwuzaFLpZheAj6zMxJJ.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Nickelodeon)</span></figcaption></figure><h2 id="trina-vega-victorious">Trina Vega (Victorious)</h2><p>Trina Vega (Daniella Monet) – the older sister of Victoria Justice's Tori Vega, the central character from Nickelodeon's <em>Victorious</em> – is a perfect representation of the exact kind of person I am most infuriated by. Her aggressively selfish delusions about her looks and talent have robbed her of any humility, convincing her she is justified in putting down anyone she believes is lesser than her, which is just about everyone she encounters.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="4GkMaPiQ9LpcJWoYxi6nwM" name="sue the middle.jpg" alt="Sue smiling really big on The Middle." src="https://cdn.mos.cms.futurecdn.net/4GkMaPiQ9LpcJWoYxi6nwM.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="sue-heck-the-middle">Sue Heck (The Middle)</h2><p><em>The Middle</em> is a sitcom that gives you reason to find any of the central family's children annoying, but many seem to be especially perturbed by Sue Heck (Eden Sher). While some fans admire the brace-faced middle child's unbridled optimism, others feel she could take things down a notch.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Q8ods3L76HTaDmZxz4n7mU" name="Full House Jodie Sweetin Dance" alt="Stephanie getting ready to dance on Full House." src="https://cdn.mos.cms.futurecdn.net/Q8ods3L76HTaDmZxz4n7mU.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Max)</span></figcaption></figure><h2 id="stephanie-tanner-full-house">Stephanie Tanner (Full House)</h2><p>I think any fan of <em>Full House</em> would agree that the sitcom's most annoying character is not any member of the blended central family, but D.J.'s best friend, Kimmy Gibbler (Andrea Barber). However, among the Tanners, middle daughter Stephanie (Jodie Sweetin) would have to take the cake, especially in the earlier seasons when she displayed overdramatic and bratty tendencies and would withhold important information because "nobody asked" her about it.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="T9RHpK7gVHDt8BW2xDNarV" name="home improvement tim brad.jpg" alt="Tim and Brad in hospital room on Home Improvement" src="https://cdn.mos.cms.futurecdn.net/T9RHpK7gVHDt8BW2xDNarV.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Hulu)</span></figcaption></figure><h2 id="brad-taylor-home-improvement">Brad Taylor (Home Improvement)</h2><p>Just about every character in the <a href="https://www.cinemablend.com/television/2562297/what-the-home-improvement-cast-is-doing-now-including-tim-allen"><em>Home Improvement</em> cast</a> has something to like about them, but I think the one with the least criteria is Tim (Tim Allen) and Jill (Patricia Richardson)'s oldest son, Brad Taylor (Zachary Ty Bryan). In early seasons, he was the most notorious for tormenting his youngest and most meek brother, Mark, and his intelligence only seemed to regress as he got older.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="eNgauwrWdHodmHd5NSYAam" name="philofthefutureamybruckner.jpg" alt="Amy Bruckner in Phil of the Future" src="https://cdn.mos.cms.futurecdn.net/eNgauwrWdHodmHd5NSYAam.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney)</span></figcaption></figure><h2 id="pim-diffy-phil-of-the-future">Pim Diffy (Phil Of The Future)</h2><p>The Diffy family from Disney Channel's sci-fi sitcom, <em>Phil of the Future</em>, would often come closest to revealing their true identities as a 22nd-Century clan trapped in the past because of the eponymous teen's younger sister, Pim (Amy Bruckner). Not only was she prone to relying on her family's futuristic gadgets for personal gain, but she also aspired to use them to take over the world.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="k5N67fSNZF2wLVQaHdCWCL" name="cailloupout.jpg" alt="Caillou from Caillou" src="https://cdn.mos.cms.futurecdn.net/k5N67fSNZF2wLVQaHdCWCL.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: PBS)</span></figcaption></figure><h2 id="caillou-caillou">Caillou (Caillou)</h2><p>While the titular 4-year-old from <em>Caillou</em> had a younger sister named Rosie, he was easily the biggest baby of his family by behavior alone. I remember, even as a youngster, feeling so annoyed by the kid's crybaby temperament that I could not bring myself to watch PBS' adaptation of the illustrated Canadian children's books any longer.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Ae9dfNx7jxNDRxWeGDwZx6" name="everybodyhatescrhistonya" alt="Imani Hakim as Tonya Rock arguing with her brother on Everybody Hates Chris" src="https://cdn.mos.cms.futurecdn.net/Ae9dfNx7jxNDRxWeGDwZx6.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Paramount)</span></figcaption></figure><h2 id="tonya-everybody-hates-chris">Tonya (Everybody Hates Chris)</h2><p>Tonya (Imani Hakim) from <em>Everybody Hates Chris</em> serves as a definitive representation of what happens when you spoil your children, just like her father, Julius (Terry Crews), did. As a result, the Rock Family's youngest turned out to be a mercilessly controlling bully, especially to the titular eldest kid (Tyler James Williams, a <a href="https://www.cinemablend.com/movies/former-child-stars-who-are-still-acting-today">former child star who still acts</a> today).</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="fvACVCiNBQpaarGmr3S9L8" name="malcolmjustinberfield.jpg" alt="Justin Berfield on Malcolm in the Middle" src="https://cdn.mos.cms.futurecdn.net/fvACVCiNBQpaarGmr3S9L8.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="reese-malcolm-in-the-middle">Reese (Malcolm In The Middle)</h2><p>There are plenty of reasons why you could argue that the most annoying child character in the <a href="https://www.cinemablend.com/television/2563294/what-the-malcolm-in-the-middle-cast-is-doing-now-including-bryan-cranston"><em>Malcolm in the Middle</em> cast</a> is Dewey (Erik Per Sullivan). However, his intelligence and temperance significantly outweigh that of the second oldest brother, Reese (Justin Berfield), who seemed to thrive on insubordination, made worse by his hopelessly foolish instincts.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="iR4AUSsT8M3PKwTCDi4sPE" name="155172_0016-1280.jpg" alt="The titular characters Phineas and Ferb with their sister, Candace." src="https://cdn.mos.cms.futurecdn.net/iR4AUSsT8M3PKwTCDi4sPE.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney Channel)</span></figcaption></figure><h2 id="candace-flynn-phineas-and-ferb">Candace Flynn (Phineas And Ferb)</h2><p>The titular stepbrothers from Disney Channel's <a href="https://www.cinemablend.com/television/the-75-best-animated-TV-shows-of-all-time">beloved animated series</a>, <em>Phineas and Ferb</em> (voiced by Vincent Martella and Thomas Sangster), want nothing more than to make every day of their summer vacation the best day possible. Thus, I find it genuinely distressing that their older sister, Candace (Ashley Tisdale), constantly goes out of her way to ruin their fun for vague and selfish reasons when she should just learn to relax.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="N3LxUWcTYjqpaHo4cAATEo" name="familyguystewiegriffinangry" alt="Seth MacFarlane as Stewie Griffin angry in Family" src="https://cdn.mos.cms.futurecdn.net/N3LxUWcTYjqpaHo4cAATEo.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="stewie-grffin-family-guy">Stewie Grffin (Family Guy)</h2><p>Honestly, out of all these annoying TV siblings, I think I do enjoy Stewie Griffin (voiced by <em>Family Guy</em> creator Seth MacFarlane) because the sophisticated infant is pretty funny. However, I have never understood why he is so committed to murdering his mother, Lois (Alex Borstein).</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="q3Ne8m6ALRLASZw5b4RdM7" name="kel kyra.jpg" alt="Vanessa Baden and Kel Mitchell on Kenan & Kel" src="https://cdn.mos.cms.futurecdn.net/q3Ne8m6ALRLASZw5b4RdM7.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Nickelodeon)</span></figcaption></figure><h2 id="kyra-rockmore-kenan-kel">Kyra Rockmore (Kenan & Kel)</h2><p>Something I noticed while <a href="https://www.cinemablend.com/television/kenan-and-kel-thoughts-i-had-rewatching-the-nickelodeon-show-on-netflix">rewatching <em>Kenan & Kel</em> as an adult</a> is that Kenan Rockmore's (future <a href="https://www.cinemablend.com/television/9-Saturday-Night-Live-Cast-Members-Who-Appeared-Show-Longest-72101.html">long-running <em>SNL</em> cast member</a> Kenan Thompson) younger sister, Kyra (Vanessa Baden), only has one defining character trait: her ridiculous crush on Kel Kimble (Kel Mitchell). The fact that the writers of the otherwise hilarious Nickelodeon sitcom never bothered to develop her beyond that quirk is truly what makes her annoying to me.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="kpg9uzPoEXDfFj9t6WVBDN" name="clarissajasonzimbler.jpg" alt="Jason Zimbler on Clarissa Explains It All" src="https://cdn.mos.cms.futurecdn.net/kpg9uzPoEXDfFj9t6WVBDN.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Nickelodeon)</span></figcaption></figure><h2 id="ferguson-darling-clarissa-explains-it-all">Ferguson Darling (Clarissa Explains It All)</h2><p>What did Clarissa Darling (Melissa Joan Hart's first starring role, in <em>Clarissa Explains It All</em>) do to deserve a younger brother as snooty, pretentious, and invasive as Ferguson? I cannot help but wonder if Jason Zimbler's years playing such an annoying kid on the Nickelodeon comedy inspired the <a href="https://www.cinemablend.com/movies/child-actors-that-left-hollywood-behind-and-what-happened-to-them">former child star to walk away from the spotlight</a> and become a software engineer (according to <a href="https://www.thesun.co.uk/tv/24674045/clarissa-explains-it-all-fergus-jason-zimbler-unrecognisable/">The Sun</a>).</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="yzBhwfv5iH9Dv3uEa3KN3P" name="littlehousecarrie" alt="Carrie smiling on Little House on the Prairie" src="https://cdn.mos.cms.futurecdn.net/yzBhwfv5iH9Dv3uEa3KN3P.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="carrie-ingalls-little-house-on-the-prairie">Carrie Ingalls (Little House On The Prairie)</h2><p>In the earlier years of <em>Little House on the Prairie</em>'s run, Carrie (played by twin sisters Lindsay and Sidney Greenbush) and her struggles to pronounce comprehensible lines of dialogue was one of the most adorable aspects of the period family drama. However, as the series adaptation of Laura Ingalls Wilder's autobiographical novels went on, the third Ingalls child never really seemed to grow up, and viewers were not too charmed by her immaturity. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="wPYStbXkJ8p6httSNsU63V" name="groudedforlifehenry" alt="Jake Burbage as Henry staring intently on Grounded for LIfe" src="https://cdn.mos.cms.futurecdn.net/wPYStbXkJ8p6httSNsU63V.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: The Carsey-Werner Company)</span></figcaption></figure><h2 id="henry-finnerty-grounded-for-life">Henry Finnerty (Grounded For Life)</h2><p>After actor Jake Burbage moved away from the set of <em>Grounded for Life</em> with his family, his character, Henry Finnerty, disappeared from the show's fifth and final season. I must admit, I was pretty relieved that I did not have to see any more of Sean (Donal Logue) and Claudia's (Megyn Price)  third child – an incessant chatterbox with a tendency to stir up trouble in the household for no reason other than, perhaps, because he wants to watch the world burn.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="NBi7pkracFsmzDScTz6H5G" name="strangerthingserica" alt="Erica on Stranger Things" src="https://cdn.mos.cms.futurecdn.net/NBi7pkracFsmzDScTz6H5G.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="erica-sinclair-stranger-things">Erica Sinclair (Stranger Things)</h2><p>I can understand why some <em>Stranger Things</em> fans believe that Dustin Sinclair's (Caleb McLaughlin) younger sister, Erica (Priah Ferguson), and her unbridled boisterousness makes her the acclaimed Netflix sci-fi TV show's real MVP, especially in Season 3. However, let me just say that if I had her as a sibling, I would not know what to do with myself.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="G29TnkcfqS77AjcMas9MNC" name="lizziematt" alt="Matt McGuire yelling at Lizzie at her bedroom door on Lizzie McGuire" src="https://cdn.mos.cms.futurecdn.net/G29TnkcfqS77AjcMas9MNC.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney)</span></figcaption></figure><h2 id="matt-mcguire-lizzie-mcguire">Matt McGuire (Lizzie McGuire)</h2><p>Fun fact about myself: <em>Lizzie McGuire</em> first started airing on Disney Channel around the time my sibling was born. After getting pretty fed up with the ridiculously antagonizing rivalry between Hilary Duff's eponymous teen and her mischievous younger brother (played by Jake Thomas), I promised to never let my relationship with my sister evolve into anything remotely similar. So, I guess I have Matt to thank for that.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="DkhALRwPa7thXuaCUfhfVe" name="arthurdw" alt="D.W. Read blowing out her birthday candles on Arthur" src="https://cdn.mos.cms.futurecdn.net/DkhALRwPa7thXuaCUfhfVe.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: PBS)</span></figcaption></figure><h2 id="d-w-read-arthur">D.W. Read (Arthur)</h2><p>Young aardvark Arthur Read turned out to be such a decent kid and yet, it seems that barely any of those same values were passed down to his sister, D.W. While the 4-year-old is might not be the most annoying character on the beloved animated series, her spoiled attitude and brutal honesty is jarring, especially for a PBS Kids show.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="4Hfvyu7uQf8dxvpjo2sXpL" name="ravencory.jpg" alt="Kyle Massey on That's So Raven" src="https://cdn.mos.cms.futurecdn.net/4Hfvyu7uQf8dxvpjo2sXpL.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney)</span></figcaption></figure><h2 id="cory-baxter-that-s-so-raven">Cory Baxter (That's So Raven)</h2><p>While <em>That So Raven</em>'s Raven Baxter (Raven-Symoné) has the ability to see the future, she can't seem to notice that she can be deeply self-centered and bossy. However, her younger brother, Cory (Kyle Massey), is described in the first episode of the hit Disney Channel series as "a master in deceit and the art of psychological manipulations" and would typically apply these skills purely for his own benefit and to the detriment of others.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="DBmZDPiRMtaJRDPQ5yvm7V" name="unnamed.jpg" alt="Dexter and Dee Dee in Dexter's Laboratory" src="https://cdn.mos.cms.futurecdn.net/DBmZDPiRMtaJRDPQ5yvm7V.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Hanna-Barbera Cartoons)</span></figcaption></figure><h2 id="dee-dee-dexter-s-laboratory">Dee Dee (Dexter’s Laboratory)</h2><p>I will admit, the unusually intelligent and deeply arrogant title character of <em>Dexter's Laboratory</em> is someone I often had trouble warming to. On the other hand, I did empathize with him having to deal with his overactive and ditzy older sister, Dee Dee, and her tendency to make waste of his experiments on many occasions.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="2gCM42eHH85ZGGf4mzjK6" name="david-schwimmer-friends.jpg" alt="David Schwimmer as Ross Geller on Friends." src="https://cdn.mos.cms.futurecdn.net/2gCM42eHH85ZGGf4mzjK6.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros.)</span></figcaption></figure><h2 id="ross-gellar-friends">Ross Gellar (Friends)</h2><p>Who says this list has to be exclusive to kids when there are also grown-up TV siblings as irritating as the most annoying character in the <a href="https://www.cinemablend.com/television/2474356/what-have-the-friends-cast-been-up-to-since-the-show-ended"><em>Friends</em> cast</a>, Ross Gellar? There are many reasons why <a href="https://www.cinemablend.com/television/2488249/friends-reasons-why-ross-is-the-worst">David Schwimmer's character is just the worst</a> and why his younger sister, Monica (Courteney Cox), is easily the more mature sibling. He is incessantly needy, hypocritical, and, perhaps worst of all, possessive over Rachel (Jennifer Aniston).</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="7qJWKX3thnrL75bqBs8ZdN" name="ededdeddysarah" alt="A disgruntled Sarah on Ed, Edd n Eddy" src="https://cdn.mos.cms.futurecdn.net/7qJWKX3thnrL75bqBs8ZdN.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros. / Cartoon Network)</span></figcaption></figure><h2 id="sarah-ed-edd-n-eddy">Sarah (Ed, Edd N Eddy)</h2><p>With the exception of, maybe, Nazz, just about all of the unsupervised youngsters from <em>Ed, Edd n Eddy</em> were a handful, especially the dim-witted Ed (Matt Hill). Of course, even he was an absolute prize when compared to his younger sister, Sarah (Janyse Jaud), who is one of the most terrifyingly short-tempered kids on the cul-de-sac.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="EqrF8fa32RA6aSabqAfhj6" name="that70sshowlisarobinkelly.jpg" alt="Lisa Robin Kelly on That '70s Show" src="https://cdn.mos.cms.futurecdn.net/EqrF8fa32RA6aSabqAfhj6.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="laurie-forman-that-70s-show">Laurie Forman (That ‘70s Show)</h2><p>If it were not for Red (Kurtwood Smith) showing her favoritism, Laurie Forman would have taken a lot more heat from him and Kitty (Debra Jo Rupp) than her younger and meeker brother, Eric (Topher Grace), did on <em>That '70s Show</em>. Originally played by the late Lisa Robin Kelly before a <a href="https://www.cinemablend.com/television/tv-shows-that-had-major-cast-shake-ups-during-their-runs">casting shake-up</a> brought in Christina Moore, Laurie constantly bullied her brother and belittled her mother, seduced Kelso (Ashton Kutcher) into cheating on Jackie (Mila Kunis) with her, and was even unfaithful in her green card marriage to Fez (Wilmer Valderama).</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="bBuTxToUPhAuqDCxGqhTpP" name="heyarnoldtimberley" alt="Timberly peeking from behind a door smiling on Hey Arnold!" src="https://cdn.mos.cms.futurecdn.net/bBuTxToUPhAuqDCxGqhTpP.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Paramount / Nickelodeon)</span></figcaption></figure><h2 id="timberly-johanssen-hey-arnold">Timberly Johanssen (Hey Arnold!)</h2><p>Some of the most distressing predicaments and misadventures that Arnold and Gerald went through on <em>Hey Arnold!</em> were caused by Gerald's younger sister, Timberly. For instance, there was the time the best friends tried their hand at selling chocolate turtles but lost all of their product when Timberly ate them, forcing them to make them from scratch.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="X96Aa98Qr8BbFCKENrkRRb" name="marriedchildrenchristinapplegate.jpg" alt="Christina Applegate on Married... with Children" src="https://cdn.mos.cms.futurecdn.net/X96Aa98Qr8BbFCKENrkRRb.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="kelly-bundy-married-with-children">Kelly Bundy (Married... With Children)</h2><p>If Bud Bundy (David Faustino) was not blessed with a far higher intelligence than his aggressively selfish older sister, Kelly (Christina Applegate), I might be inclined to call him the more annoying child from the <a href="https://www.cinemablend.com/television/tv-shows-about-blue-collar-characters">iconic blue-collar TV show</a>, <em>Married... with Children</em>. Either way, these siblings were already destined for ruin growing up in a household run by Al (Ed O'Neill) and Peg (Katey Segal).</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="DSDrnJ39KAEFrueQEcvmhn" name="wildthornberrysdebbie" alt="Debbie Thornberry scowling on The Wild Thornberrys" src="https://cdn.mos.cms.futurecdn.net/DSDrnJ39KAEFrueQEcvmhn.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Paramount / Nickelodeon)</span></figcaption></figure><h2 id="debbie-thornberry-the-wild-thornberrys">Debbie Thornberry (The Wild Thornberrys)</h2><p>On Nickelodeon's <em>The Wild Thornberrys</em>, the central character, Eliza (voiced by Lacey Chabert), always showed gratitude for the opportunity her parents gave her to travel the world and learn about different cultures and animal species. The same cannot be said about her conceited older sister, Debbie (Danielle Harris), who always had something to complain about on their many adventures.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="kn3WKyhCtG4cnnxMTydBg5" name="wonderyearswayne" alt="Jason Hervey as Wayne Arnold with pretzels in his mouth and ears on The Wonder Years" src="https://cdn.mos.cms.futurecdn.net/kn3WKyhCtG4cnnxMTydBg5.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="wayne-arnold-the-wonder-years">Wayne Arnold (The Wonder Years)</h2><p>Growing up in the late 1960s and early 1970s did not look easy from the perspective of Kevin Arnold (Fred Savage), especially when you have an older brother like Wayne. Jason Hervey's character from <em>The Wonder Years</em> was TV's definitive nightmare sibling during its six-season run from 1988 to 1993.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="X4Yut25WnwyqcjibAZLpL8" name="bradybunchcindy" alt="Cindy from The Brady Bunch" src="https://cdn.mos.cms.futurecdn.net/X4Yut25WnwyqcjibAZLpL8.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Paramount)</span></figcaption></figure><h2 id="cindy-brady-the-brady-bunch">Cindy Brady (The Brady Bunch)</h2><p>For her naivety and tendency to tattle on her siblings, Cindy (Susan Olsen) is among the young characters from <em>The Brady Bunch</em> I would least like to have as a sibling.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="6JPXhgFsSTqp8GZWDBiEPZ" name="joncryertwoandahalfmen.jpg" alt="Jon Cryer on Two and a Half Men" src="https://cdn.mos.cms.futurecdn.net/6JPXhgFsSTqp8GZWDBiEPZ.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="alan-harper-two-and-a-half-men">Alan Harper (Two And A Half Men)</h2><p>Back when I watched <em>Two and a Half Men</em>, I always had empathy for Alan Harper (Jon Cryer) as a divorced father with perpetual struggles to find love and financial stability. However, for his hypocritical tendencies, sniveling pretentiousness, and for being a freeloader, I have more sympathy for the guy who has to live with him: his older brother, Charlie (Charlie Sheen).</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="4nA35KZ5jEZ53SXSQksMLf" name="livmaddie2.jpg" alt="dove cameron on liv and maddie" src="https://cdn.mos.cms.futurecdn.net/4nA35KZ5jEZ53SXSQksMLf.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney)</span></figcaption></figure><h2 id="liv-rooney-liv-and-maddie">Liv Rooney (Liv And Maddie)</h2><p>One of the reasons why <em>Liv and Maddie</em> is one of the <a href="https://www.cinemablend.com/streaming-news/dove-cameron-what-to-watch-if-you-like-the-singeractress">best TV shows for Dove Cameron fans to watch</a> is her impressive, Daytime Emmy-winning performance as both of the titular sisters, who could not be more different. While Maddie is smart and kindhearted, Liv is absent-minded and completely full of herself.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="r2eFSbxN8bQv2HopRJjKDP" name="maxrubymax" alt="Max pushing a box on Max & Ruby" src="https://cdn.mos.cms.futurecdn.net/r2eFSbxN8bQv2HopRJjKDP.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Nelvana Limited)</span></figcaption></figure><h2 id="max-max-ruby">Max (Max & Ruby)</h2><p>Both of the titular rabbit siblings from the Canadian children's program, <em>Max & Ruby</em>, have their faults, considering the older Ruby's bossy nature. However, the three-year-old Max and his rambunctiousness and overeagerness were known to test her patience quite often.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ 32 Shows That Are Perfect For Background Noise While Folding Laundry ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/shows-perfect-background-noise-while-folding-laundry</link>
                                                                            <description>
                            <![CDATA[ Need to take care of that ever-growing pile of laundry? ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">XRSFYpTHKiLZT7EPWfyiJo</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/KvZzvwKsktQrvgojGPpQbA-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Wed, 26 Feb 2025 17:33:00 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Philip Sledge ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/EkAcyCb4XhyxmBbguSQhEX.jpg ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Philip Sledge is a content writer at CinemaBlend with a focus on longform features. He started writing for the website in December 2019, though his journey in journalism started years earlier. Writing gigs with school newspapers, multiple daily newspapers, and other varied job experiences led him to this point where he actually gets to write about movies, shows, wrestling, and documentaries (which is a huge win in his eyes).&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Into&lt;/strong&gt;: As has been in the case for many years, Philip loves all things professional wrestling (especially early &#039;90s WCW and late-stage WCW if we&#039;re being honest). But outside of the squared circle, Philip is obsessed with all things George A. Romero as you can probably tell by the plethora of zombie stories he&#039;s written over the years. Documentaries, especially Frontline specials, are another passion for Philip, and he can often be heard going on and on about why everyone should watch some random doc about an obscure movie no one has ever seen before.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Excited About Right Now&lt;/strong&gt;: Oppenheimer... so much so that his wife has asked him multiple times to stop talking about it (but he keeps doing it). He&#039;s also into Peacock&#039;s Twisted Metal series, which has rekindled his love of the classic vehicular combat video game. And since we&#039;re being all nostaglic, he&#039;s pumped to see Teenage Mutant Ninja Turtles: Mutant Mayhem.&lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/KvZzvwKsktQrvgojGPpQbA-1280-80.jpg">
                                                            <media:credit><![CDATA[NBC]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Tina Fey as Liz Lemon Pete scene.]]></media:description>                                                            <media:text><![CDATA[Tina Fey as Liz Lemon Pete scene.]]></media:text>
                                <media:title type="plain"><![CDATA[Tina Fey as Liz Lemon Pete scene.]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/KvZzvwKsktQrvgojGPpQbA-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>It’s not too much of a stretch to say that we’ve all been in a position where we put off folding laundry for so long we’re left with a giant mound of clothes, sheets, towels, and orphaned socks. What do you do in that situation? Put on a show that is perfect for background noise, of course! </p><p>With some of the <a href="https://www.cinemablend.com/television/the-75-best-animated-TV-shows-of-all-time"><u>best cartoons of all time</u></a>, one or two of the <a href="https://www.cinemablend.com/television/100-best-tv-sitcoms-of-all-time-ranked"><u>greatest sitcoms ever made</u></a>, or random docuseries and educational programs, here’s a list of 32 shows that are perfect for background noise while folding laundry.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Y3hGWLmJ4jSS5Davs3NBkT" name="Law & Order Jack.jpg" alt="Sam Waterston on Law and Order" src="https://cdn.mos.cms.futurecdn.net/Y3hGWLmJ4jSS5Davs3NBkT.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="law-order-1990-2010-2022-present">Law & Order (1990 - 2010; 2022 - Present)</h2><p><em>Law & Order</em>, with its 500-plus episodes, has made the laundry-folding process a little better for decades now thanks to its grisly murders, captivating courtroom sequences, and too many “Jack McCoy” moments to count. This isn’t a knock on the show, but you don’t even really have to pay attention all that much to know what’s going on.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="3hFWCj2JmCm7HZBLQRB4v4" name="How It's Made" alt="A shot of crayons in How It's Made" src="https://cdn.mos.cms.futurecdn.net/3hFWCj2JmCm7HZBLQRB4v4.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Science Channel)</span></figcaption></figure><h2 id="how-it-s-made-2001-2019">How It's Made (2001 - 2019)</h2><p>Okay, you might get distracted by the manufacturing processes for things like Crayons, crackers, pillows, bowling balls, and thousands of other items featured on this long-running educational program, but <em>How It’s Made</em> makes for some great background noise. The soothing narration, that catchy music, and endless shots of everyday items being made make this a perfect option.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="75zXyEkDytpKhC7oRkcnQ7" name="Home Improvement Tim Allen Rich Karn.jpg" alt="Tim Allen and Richard Karn in Home Improvement." src="https://cdn.mos.cms.futurecdn.net/75zXyEkDytpKhC7oRkcnQ7.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Hulu/ABC)</span></figcaption></figure><h2 id="home-improvement-1991-1999">Home Improvement (1991 - 1999)</h2><p>Tim “The Tool Man” Taylor (Tim Allen) probably never folded a shirt in his life (at least not properly), but that doesn’t mean <em>Home Improvement</em> is a great option for the laundry-folding machine in all of us. If you’re folding one basket, or two baskets, or trying to save your room from the pile that never goes away, this beloved ‘90s TV show will help you pass the time.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="5TJ8UQVHkjcfkCur3BjjsK" name="HT_the_simpsons_jef_161014_hpMain_3_16x9t_992.jpg" alt="The Simpsons" src="https://cdn.mos.cms.futurecdn.net/5TJ8UQVHkjcfkCur3BjjsK.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: FOX)</span></figcaption></figure><h2 id="the-simpsons-1989-present">The Simpsons (1989 - Present)</h2><p>With countless <a href="https://www.cinemablend.com/television/tv-characters-we-love-to-hate"><u>characters we love to hate</u></a>, all kinds of zany situations, and more than 700 episodes to choose from, <em>The Simpsons</em> is one of those shows you can have on in the background in any situation. So, it’s not all surprising that this is a great option for laundry day.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="GwZuJvzTJQxUNVdYwaDtgm" name="MV5BMjg2MTQ5OTctNWZkMi00MTdhLWI3MDctYWQ1NjhkOTI1YmJmXkEyXkFqcGdeQXVyMDgyNjA5MA@@._V1_.jpg" alt="The West Wing" src="https://cdn.mos.cms.futurecdn.net/GwZuJvzTJQxUNVdYwaDtgm.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="the-west-wing-1999-2006">The West Wing (1999 - 2006)</h2><p>Considered one of <a href="https://www.cinemablend.com/television/great-peak-tv-era-shows"><u>the “peak TV era” shows</u></a>, <em>The West Wing</em> was a staple of network television in the late ‘90s and early 2000s. That said, it’s not hard to imagine that at least a few people have gone through much of the Bartlet Administration while folding and pressing their laundry. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="VzhvF9BYVGX8ZYhfep9F4R" name="ross and rachel arguing in front of monica and joey" alt="Ross and Rachel arguing in front of Monica and Joey in Friends" src="https://cdn.mos.cms.futurecdn.net/VzhvF9BYVGX8ZYhfep9F4R.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros. Television )</span></figcaption></figure><h2 id="friends-1994-2004">Friends (1994 - 2004)</h2><p>When you have an episode with a title like“ The One with the East German Laundry Detergent,” you know <em>Friends</em> is going to be a great show to have on while folding your clothes. The landmark sitcom is pretty much the TV equivalent of a warm blanket, so it makes total sense.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="YTZ7umrpjycm2MQ3MqKPbN" name="Unsolved MysteriesRobertStack.jpg" alt="Robert Stack on Unsolved Mysteries" src="https://cdn.mos.cms.futurecdn.net/YTZ7umrpjycm2MQ3MqKPbN.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="unsolved-mysteries-1987-present">Unsolved Mysteries (1987 - Present)</h2><p>One of the greatest true crime shows to ever hit the small screen, <em>Unsolved Mysteries</em> has been there for many of us for years. First, the classic episodes hosted by Robert Stack helped us pass the time and eat snacks after school. Now, those very same episodes (as well as the Netflix revival) are there for… laundry. Where all these clothes come from is the real unsolved mystery in households around the country.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="7YDSvbhnYEe4croCqUgaDg" name="Scrubs .jpg" alt="Donald Faison and Zach Braff on Scrubs" src="https://cdn.mos.cms.futurecdn.net/7YDSvbhnYEe4croCqUgaDg.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="scrubs-2001-2010">Scrubs (2001 - 2010)</h2><p>Bill Lawrence’s <em>Scrubs</em> is one of the best comedies set in a hospital and one of the best medical shows of all time. That said, it’s also a perfect show to watch while folding laundry. Well, unless you experience one of J.D.’s elaborate daydreams while sorting socks. Maybe that explains where those missing socks have gone.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="rNcuYyF66fo5USPDpzcDsU" name="ted danson cheers.JPG" alt="A screenshot of Ted Danson leaning against the bar in Cheers." src="https://cdn.mos.cms.futurecdn.net/rNcuYyF66fo5USPDpzcDsU.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="cheers-1982-1993">Cheers (1982 - 1993)</h2><p>No judging here, but some of us have a certain stack of clothes that are pretty much like Norm from <em>Cheers </em>at this point. You know that the laundry will be there tomorrow like it was there today and yesterday (and the day before that). </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="yQ8pBsLDL2v3WZ9hPvUPu4" name="Planet Earth" alt="A baby panda in Planet Earth" src="https://cdn.mos.cms.futurecdn.net/yQ8pBsLDL2v3WZ9hPvUPu4.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: BBC)</span></figcaption></figure><h2 id="planet-earth-2006">Planet Earth (2006)</h2><p><em>Planet Earth</em> is one of those shows that’s perfect for just about any task around the house, especially with David Attenborough’s comforting narration perfectly explaining everything on the screen. And who knows, maybe you’ll go through the entire docuseries and its various sequels and spinoffs by the time you finish.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="AgAZBZbxdRkf5vpML5pkR3" name="imageedit_1146_6984578121.png" alt="burn notice jeffrey donovan michael screenshot" src="https://cdn.mos.cms.futurecdn.net/AgAZBZbxdRkf5vpML5pkR3.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: USA)</span></figcaption></figure><h2 id="burn-notice-2007-2013">Burn Notice (2007 - 2013)</h2><p>Aziz Ansari’s cousin Harris loves <em>Burn Notice</em>, but does he love watching the USA Network original show while folding his clothes? We’re kind of afraid to ask. Regardless, this spy series starring Jeffrey Donovan, Gabrielle Anwar, and Bruce Campbell is one of those shows that feels tailor-made for the mindless task of laundry sorting.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="tMsRUPhNomfUvwinjfv2G" name="Mustard Tiger.jpg" alt="Richard Collins on Trailer Park Boys" src="https://cdn.mos.cms.futurecdn.net/tMsRUPhNomfUvwinjfv2G.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Showcase)</span></figcaption></figure><h2 id="trailer-park-boys-2001-2007-2014-2018">Trailer Park Boys (2001 - 2007; 2014 - 2018)</h2><p><em>Trailer Park Boys</em> probably isn’t the first show that comes to mind when you’re trying to be productive, but this Canadian comedy series about the residents of Sunnyvale Trailer Park is the very definition of mindless, crude entertainment. Sure, you won’t want the kids around with the show’s profanity, but this would be great for a late-night laundry session.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="XtUaviboXUc3iwVoxReRsY" name="tinafeypizz.jpg" alt="Tina Fey eating giant pizza slice on 30 Rock" src="https://cdn.mos.cms.futurecdn.net/XtUaviboXUc3iwVoxReRsY.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="30-rock-2006-2013">30 Rock (2006 - 2013)</h2><p>With seven seasons and nearly 140 episodes to watch, <em>30 Rock</em> has more than enough laughs and crazy moments to get you through even the biggest of laundry piles. With its cast of characters working on the fictional <em>TGS</em> sketch comedy series, this beloved NBC comedy will do the trick.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="FcFgeXgQ56jeACGsK8mq7d" name="Full House.jpg" alt="John Stamos and Dave Coulier on  Full House" src="https://cdn.mos.cms.futurecdn.net/FcFgeXgQ56jeACGsK8mq7d.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="full-house-1987-1995">Full House (1987 - 1995)</h2><p>What would Danny Tanner do? Well, he probably wouldn’t let his laundry situation get out of hand, despite having an ever-growing group of roommates. All jokes aside about the <em>Full House</em> patriarch’s obsession with cleanliness and order, this long-running sitcom has gotten millions of people through laundry baskets over the years. Join in on the fun.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="8EvUSvzMAmsi66Ky3j8npi" name="Dumpster-Baby-Always-Sunny" alt="Dumpster Baby cries with the gang in It's Always Sunny In Philadelphia" src="https://cdn.mos.cms.futurecdn.net/8EvUSvzMAmsi66Ky3j8npi.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: FXX)</span></figcaption></figure><h2 id="it-s-always-sunny-in-philadelphia-2005-present">It's Always Sunny In Philadelphia (2005 - Present)</h2><p>Now, there’s a chance you get distracted by all those <a href="https://www.cinemablend.com/television/the-funniest-thing-about-each-of-always-sunnys-biggest-side-characters"><u>absurd </u><u><em>It’s Always Sunny in Philadelphia</em></u><u> side characters</u></a> (or even the main cast), but this FX comedy series is peak-laundry folding material. Just make sure you don’t come up with some ridiculous scheme to hide the clothes or pass the task on to someone else.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="n3LMqNRktisdBhebu62wnD" name="the office dwight stress relief" alt="Dwight looking at the camera in The Office" src="https://cdn.mos.cms.futurecdn.net/n3LMqNRktisdBhebu62wnD.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="the-office-2005-2013">The Office (2005 - 2013)</h2><p>Though <a href="https://www.cinemablend.com/television/moment-shows-jumped-the-shark"><u>the series did “jump the shark”</u></a> near the end, <em>The Office</em> is still one of the best American sitcoms ever made. With a total of 201 episodes and thousands of hilarious and iconic jokes, there’s more than enough to keep you entertained while you work your way through that basket of socks that’s been taunting you for years.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="dANGeepr9SAAC2HnpACqah" name="rickharrisonpawnstars.jpg" alt="Rick Harrison on Pawn Stars" src="https://cdn.mos.cms.futurecdn.net/dANGeepr9SAAC2HnpACqah.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: History Channel)</span></figcaption></figure><h2 id="pawn-stars-2009-present">Pawn Stars (2009 - Present)</h2><p>With more than 650 episodes, all kinds of remarkable and odd pieces of memorabilia and historical artifacts, <em>Pawn Stars</em> has been one of the most popular shows on the History Channel for years now. And while we would love to be able to say “I know a guy” who can handle all these clothes, Rick Harrison and company at Gold & Silver Pawn Shop will help make the folding process a little more entertaining.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="d86umWUiAWkHSd3FGddPab" name="Mike Wolfe" alt="Mike Wolfe talking to camera in American Pickers Season 24" src="https://cdn.mos.cms.futurecdn.net/d86umWUiAWkHSd3FGddPab.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: History)</span></figcaption></figure><h2 id="american-pickers-2010-present">American Pickers (2010 - Present)</h2><p>Like a lot of other great History Channel shows, <em>American Pickers</em> is one of those series perfect for background noise. You don’t really have to follow along to the finer points of the reality program, which is perfect when you’re about halfway through a load of clothes that you really need to finish.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="C6Ucq7SzJzBjtaEiAwSRt6" name="controversyseinfeld" alt="The Seinfeld cast stuck in traffic" src="https://cdn.mos.cms.futurecdn.net/C6Ucq7SzJzBjtaEiAwSRt6.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="seinfeld-1989-1998">Seinfeld (1989 - 1998)</h2><p>Who would have thought that a show about nothing would be perfect for laundry? Well, that’s the case for <em>Seinfeld</em>. Sure, you’re probably going to get distracted, put mismatched socks together, or accidentally merge the “keep” and “give away” stacks on the foot of the bed, but it’s worth it.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="raYRke23SeswkCPBvcn4pQ" name="Leslie Knope Parks and Rec vwe2" alt="Amy Poehler as Leslie Knope in Parks and Recreation" src="https://cdn.mos.cms.futurecdn.net/raYRke23SeswkCPBvcn4pQ.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="parks-and-recreation-2009-2015">Parks And Recreation (2009 - 2015)</h2><p>Though it’s unlikely that Ron Swanson would be too fond of spending hours folding clothes, <em>Parks and Recreation</em> is a show that is perfect for the task. Sure, you may be stuck in a pit of clothes that were washed weeks ago before you finally pull yourself out, but it’s all about the journey.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="y35xoEqVpURkXuiiRpNLJF" name="familyguy.jpg" alt="The Griffin family sitting on a couch" src="https://cdn.mos.cms.futurecdn.net/y35xoEqVpURkXuiiRpNLJF.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="family-guy-1999-present">Family Guy (1999 - Present)</h2><p><em>Family Guy</em>, one of the best-animated series of the 21st century, is also a great show to have on in the background while doing just about anything. This includes doing laundry. Sure, there are things we’d rather be doing than folding clothes, but this long-running Fox show certainly makes the task less mind-numbing.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="TCUoJAY3zCD47iAnFcYtfJ" name="GG BnB.jpg" alt="Lorelai and Rory at a Bed and Breakfast" src="https://cdn.mos.cms.futurecdn.net/TCUoJAY3zCD47iAnFcYtfJ.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros.)</span></figcaption></figure><h2 id="gilmore-girls-2000-2007">Gilmore Girls (2000 - 2007)</h2><p>Lorelai and Rory Gilmore guiding us through the ups and downs of small-town life is a great way to make doing laundry a lot more fun, or at least more melodramatic. With seven seasons, 153 episodes, and so many romances to explore, this is definitely a great option for folks who’ve put on laundry for like two months.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="LcThAQskBpXgf8447CBikR" name="unxplained.jpg" alt="William Shatner on The UnXplained" src="https://cdn.mos.cms.futurecdn.net/LcThAQskBpXgf8447CBikR.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: History)</span></figcaption></figure><h2 id="the-unxplained-2019-present">The UnXplained (2019 - Present)</h2><p>How did this stack of clothes get so big? Is this clean, cleanish, or dirty? Does William Shatner fold his own clothes? These are questions with no answers, but <em>The UnXplained</em> will distract you from those mysteries while you search for that missing sock or <em>No Country for Old Man</em> bootleg t-shirt that disappeared in the wash.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="HRzJAzNjUhfNdWQ2R6wtBN" name="meghanmarkle" alt="Meghan Markle as Rachel Zane smiling on Suits." src="https://cdn.mos.cms.futurecdn.net/HRzJAzNjUhfNdWQ2R6wtBN.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: USA Network)</span></figcaption></figure><h2 id="suits-2011-2019">Suits (2011 - 2019)</h2><p>From 2011 to 2019, few shows reached the heights experienced by <em>Suits</em>. This USA Network drama about the high-stakes world of corporate law introduced viewers to all kinds of characters and intense situations along the way. And while few, if any, of those managing partners and ladder-climbing associates did their own laundry, they can help you do yours.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="byHYF6gsWaTeEAUmtQtWe6" name="x-files.jpg" alt="David Duchovny and GIllian Anderson on The X-Files" src="https://cdn.mos.cms.futurecdn.net/byHYF6gsWaTeEAUmtQtWe6.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="the-x-files-1993-2002-2016-2018">The X Files (1993 - 2002; 2016 - 2018)</h2><p>A <a href="https://www.cinemablend.com/television/32-tv-shows-that-made-it-more-than-10-seasons"><u>show that made it more than 10 seasons</u></a>, <em>The X Files</em> was one of the most well-known and watched series of the ‘90s. If you want to mix things up with the laundry and imagine a world in which aliens and other paranormal creatures appear (and possibly help fold those fitted sheets), this landmark sci-fi show will do the trick.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="2hPifJtBW77w7QTP8DRRoP" name="Alison Hammond 1.jpg" alt="Alison Hammond on The Great British Baking Show" src="https://cdn.mos.cms.futurecdn.net/2hPifJtBW77w7QTP8DRRoP.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="the-great-british-baking-show-2014-present">The Great British Baking Show (2014 - Present)</h2><p><em>The Great British Baking Show</em>, or <em>The Great British Bake Off</em> as it’s known in its native United Kingdom, is one of the most delicious, hilarious, and watchable cooking shows to ever grace the small screen. While we typically prefer seeing these delectable creations (or disasters) in all their glory, maybe folding clothes will distract and prevent you from mindlessly eating as you watch.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="P4944QX9r2ELioeWjUC8VN" name="155053_3397.jpg" alt="Modern Family" src="https://cdn.mos.cms.futurecdn.net/P4944QX9r2ELioeWjUC8VN.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="modern-family-2009-2020">Modern Family (2009 - 2020)</h2><p>There’s nothing dysfunctional about the Dunphy and Pritchett families from <em>Modern Family</em>, right? Well, maybe a little. This long-running sitcom is one the best options when you’re trying to fold clothes, or really do anything around the house. You’ll be so fixated by Phil coming up with some scheme, Cameron and Mitchell having a meltdown, or Jay being over it all that you’ll forget you’re doing laundry.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="cfvEs4QCLZMGdZPdbicgVE" name="MSN Somebody Feed Phil.jpg" alt="Phil Rosenthal eating meat in Somebody Feed Phil" src="https://cdn.mos.cms.futurecdn.net/cfvEs4QCLZMGdZPdbicgVE.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="somebody-feed-phil-2018-present">Somebody Feed Phil (2018 - Present)</h2><p><em>Somebody Feed Phil</em>, a show that follows <em>Everybody Loves Raymond</em> co-creator Phil Rosenthal as he travels the globe to eat anything and everything in his field of view. With so many seasons, so many culinary explorations, and some hilarious moments involving a man loving food way too much, there’s a lot to enjoy.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="cTLuDMrEp6VAEUQBNjVzfP" name="house hugh.jpg" alt="Hugh Laurie on House" src="https://cdn.mos.cms.futurecdn.net/cTLuDMrEp6VAEUQBNjVzfP.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="house-2004-2012">House (2004 - 2012)</h2><p><em>House</em> is one of those shows you can start watching halfway through an episode and still get a lot of enjoyment out of it. One of the best medical dramas of the 21st century, this show starring Hugh Laurie as Dr. Gregory House will allow you to solve all sorts of medical problems and mysteries as you fold your kids' clothes that never really seem to get clean.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="7UESdhaEsQCdu5y5ak8CrJ" name="wall of women" alt="Jo (Camilla Luddington), Teddy (Kim Raver) and a nurse (episode writer Elisabeth Finch) wheel a patient down the hall through the wall of women on Grey's Anatomy's Season 15 episode "Silent All These Years."" src="https://cdn.mos.cms.futurecdn.net/7UESdhaEsQCdu5y5ak8CrJ.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="grey-s-anatomy-2005-present">Grey's Anatomy (2005 - Present)</h2><p>Since its debut in 2005, <em>Grey’s Anatomy</em> has combined elements of the medical drama genre with romance and sometimes action to create an experience like no other. If you’re looking for hundreds of hours of TV to help make the laundry go from a mound of madness to a stack of clothes you’ll soon forget to put away, this is the stuff.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="VTaePWTxRGZdYBc9F3VcqR" name="MTV True Life Triple H" alt="Triple H on MTV True Life" src="https://cdn.mos.cms.futurecdn.net/VTaePWTxRGZdYBc9F3VcqR.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: MTV)</span></figcaption></figure><h2 id="mtv-true-life-1998-2017">MTV True Life (1998 - 2017)</h2><p><em>MTV True Life</em> was a long-running documentary series that chronicled pretty much every aspect of life for teenagers, adults, and everyone else. With dozens of episodes about everything from wrestling to odd obsessions, you’ll have a lot of variety when you’re folding the sheets.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="UEBHAFoam7c8vVG4rMk6dV" name="ted marsh barn.jpg" alt="Marshall, Ted, and Barney on How I Met Your Mother" src="https://cdn.mos.cms.futurecdn.net/UEBHAFoam7c8vVG4rMk6dV.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="how-i-met-your-mother-2005-2014">How I Met Your Mother (2005 - 2014)</h2><p><em>How I Met Your Mother</em> has nine seasons of romance, bromance, chaos, and more twists and turns than anyone can count. That’s why it’s such a darn good show for the weekly (or monthly) laundry experience. Watch Ted Mosby fall in and out of love and back in it again as you contemplate your own life, or at least laundry decisions.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ 32 TV Homes That I Always Wanted To Explore Or Live In ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/tv-homes-that-i-always-wanted-explore-live-in</link>
                                                                            <description>
                            <![CDATA[ Look at all these rooms! ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">57LEi6e7uCqxzWYhoEu9dh</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/eaQYXaBNXWFuxAYLNd32aD-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Sun, 23 Feb 2025 21:33:20 +0000</pubDate>                                                                                                                                <updated>Tue, 04 Mar 2025 14:54:24 +0000</updated>
                                                                                                                                            <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Hugh Scott ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/gqJyioXTNQbSAisiNzZfAG.jpeg ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;The Background: Hugh Scott is the Syndication Editor for CinemaBlend. Before CinemaBlend, he was the managing editor for Suggest.com and Gossipcop.com, covering celebrity news and debunking false gossip. He has been in the publishing industry for almost two decades, covering pop culture – movies and TV shows, especially – with a keen interest and love for Gen X culture, the older influences on it, and what it has since inspired.&amp;nbsp;&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;He graduated from Boston University with a degree in Political Science but cured himself of the desire to be a politician almost immediately after graduation.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;What He&#039;s Into: When not writing and editing, he is usually going to concerts, curating playlists on Spotify, or watching concert films. In addition to music, he cooks, cleans, and fixes things around the house, especially things his 10-pound terror of a dog has destroyed in a fit of bordem.&amp;nbsp;&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;What He&#039;s Excited About Right Now: &amp;nbsp;Trips to the Cayman Islands and Alaska in 2024, and, as always, all the upcoming concerts he plans to attend.&amp;nbsp;&lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/eaQYXaBNXWFuxAYLNd32aD-1280-80.jpg">
                                                            <media:credit><![CDATA[PBS]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[A car pulling up to the front of Downton Abbey with the staff standing in front. ]]></media:description>                                                            <media:text><![CDATA[A car pulling up to the front of Downton Abbey with the staff standing in front. ]]></media:text>
                                <media:title type="plain"><![CDATA[A car pulling up to the front of Downton Abbey with the staff standing in front. ]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/eaQYXaBNXWFuxAYLNd32aD-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>From Downton Abbey to the Red Keep to 742 Evergreen Terrace, there are so many cool houses I'd love to explore from television shows. Some have even gotten <a href="https://www.cinemablend.com/television/places-that-became-famous-due-to-a-tv-show">quite famous for their use on these shows</a>. Obviously I understand these are mostly sets on a soundstage with an exterior of a completely different house, but let's take a moment to use our imagination and talk about how fun and cool these houses I've always wanted to explore would be. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="LpDwUMRcZg5TW797worr68" name="The Fresh Prince of Bel-Air Will Smith stands somberly in the middle of an empty living room" alt="Will Smith stands somberly in the middle of an empty living room in The Fresh Prince of Bel-Air series finale." src="https://cdn.mos.cms.futurecdn.net/LpDwUMRcZg5TW797worr68.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Quincy Jones-David Salzman Entertainment)</span></figcaption></figure><h2 id="the-fresh-prince-of-bel-air">The Fresh Prince Of Bel-Air</h2><p>Of course with have to include Uncle Phil and Aunt Bev's house on <em>The Fresh Prince Of Bel Air.</em> Most of the show pretty much takes place in two rooms, the kitchen and the living room, with other scenes in various bedrooms and occasionally other spots. There must be so much more to see! </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="B24NQ5pwZy9APjEdZVHzkZ" name="The Addams Family Streaming-1.jpg" alt="Carolyn Jones, John Astin, Jackie Coogan, Ted Cassidy, Blossom Rock, Lisa Loring, and Ken Weatherwax in The Addams Family" src="https://cdn.mos.cms.futurecdn.net/B24NQ5pwZy9APjEdZVHzkZ.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="the-addams-family">The Addams Family</h2><p>Who doesn't want to explore a house like that of the Addams family? It's creepy and kooky, mysterious and spooky! It's got a dismembered hand running around, a cousin covered in hair, and an uncle who can light up a light bulb in his mouth! This is the kind of house I want to learn a whole lot more about! </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="MDBPGi7ypC7wHpiH9Nq4m6" name="94 Bedford Street Friends.jpg" alt="The exterior of the apartment building from Friends" src="https://cdn.mos.cms.futurecdn.net/MDBPGi7ypC7wHpiH9Nq4m6.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="friends">Friends</h2><p>Much has been made about the apartments on <em>Friends</em> and how unrealistic they are. Sure, that may be true, but that doesn't mean <a href="https://www.cinemablend.com/television/friends-story-behind-why-they-switched-apartments-my-favorite-episode">they aren't cool</a>, especially where Monica and Rachel live. As someone who lived in a shoebox in the East Village for years, this is the kind of place I'd love to explore and dream about how I could have been living... in a fever dream. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="5446zEfveX8Ebpxktpn94R" name="Painted Ladies Full House.jpg" alt="A shot of the cast of Full House in a park in front of the Painted Ladies in San Francisco" src="https://cdn.mos.cms.futurecdn.net/5446zEfveX8Ebpxktpn94R.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="full-house-2">Full House</h2><p>The Painted Ladies in San Francisco are some of the most iconic houses in the entire United States Of America. For that reason alone it's worth it to explore the Tanner home on <em>Full House. </em>I might not have a chance to explore one otherwise (not that would in this fictional scenario anyway!) </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="oKaQZwZU94o869jYirQBUQ" name="kieran-culkin-harriet-walter-sarah-snook-jeremy-strong.jpg" alt="Roman, Shiv, Kendall and Caroline at dinner in Succession" src="https://cdn.mos.cms.futurecdn.net/oKaQZwZU94o869jYirQBUQ.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO)</span></figcaption></figure><h2 id="succession">Succession</h2><p>Let's be honest, I can't stand the Roy family and it makes it hard for me to love the show <em>Succession</em>, because I need someone to root for and there is no one on this show worthy of that. Except maybe the houses and locations, those all look amazing. So that's decides it, I'm rooting for fictional houses. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="zDmbqvjegnJyLxVfSx4ZYm" name="Game Of Thrones Red Keep" alt="The exterior of The Red Keep on a cliff near the ocean in Game Of Thrones." src="https://cdn.mos.cms.futurecdn.net/zDmbqvjegnJyLxVfSx4ZYm.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO)</span></figcaption></figure><h2 id="game-of-thrones">Game Of Thrones</h2><p>I've included the Red Keep here from <em>Game of Thrones, </em>but really it's a stand-in for basically every castle, keep, and ancestral home on the show. They all look really cool and I love old European castles, so an architectural tour of Westeros is right in my wheelhouse. Winterfell, Dragonstone, the Eyrie, Sunspear... they are all amazing. Even the ruins of Harrenhal would be awesome to hang out in for a bit. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="KGHYxabuMKy9Ly4vFRc4cM" name="Humphrey Loft Gossip Girl.jpg" alt="The exterior of an apartment building in Gossip Girl" src="https://cdn.mos.cms.futurecdn.net/KGHYxabuMKy9Ly4vFRc4cM.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: The CW)</span></figcaption></figure><h2 id="gossip-girl">Gossip Girl</h2><p>I lived a very different life in my shoebox in the East Village when I lived in New York than the families in <em>Gossip Girl</em> lived. Frankly, every location looks incredible in its own way and I want to see them all and the <a href="https://www.cinemablend.com/television/gossip-girl-outfits-i-still-cant-get-enough-of">well-dressed people who live in them</a>. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="kPwtFCZJpTDwXD2dmGvx56" name="Frasier house" alt="Cast members of Frasier walking around their apartment in the show" src="https://cdn.mos.cms.futurecdn.net/kPwtFCZJpTDwXD2dmGvx56.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="frasier">Frasier</h2><p>Frasier Crane doesn't live in the most extravagant condo in TV history, but it still seems like a really cool place. Seattle is a beautiful city and the view they had would make a quick tour very worthwhile. Plus, who doesn't want to have a good sit in Martin's chair? </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="4RWTXgUmgN3xkKdqux5szW" name="diffrentstrokesmrt.jpg" alt="Gary Coleman and Mr. T on Diff'rent Strokes" src="https://cdn.mos.cms.futurecdn.net/4RWTXgUmgN3xkKdqux5szW.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="diff-rent-strokes-2">Diff'rent Strokes</h2><p>The 1980s was filled with over-the-top residences, and the Drummonds apartment in <em>Diff'rent Strokes</em> is close to the top of the list. We really only got to see a little bit of the two-story New York apartment, as almost every scene was in the living room, kitchen, or Willis and Arnold's bedroom. I want to see more! There must be a cozy study in there somewhere with a fireplace filled with many old books and rich mahogany! </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="9LhwmKurjKudGTyenr6YAB" name="Downton Abbey Castle" alt="The exterior of Downton Abbey" src="https://cdn.mos.cms.futurecdn.net/9LhwmKurjKudGTyenr6YAB.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: PBS)</span></figcaption></figure><h2 id="downton-abbey">Downton Abbey</h2><p>Downton Abbey is one of the few fictional houses on this list that one can actually spend some time in. The house, which is known as Highclere Castle in real life, is open for tours to the public, and not only can you explore the grounds, but many of the rooms from the show as well. I've not done it yet, but I'd love to do the tour at some point. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="vXcFuQUGDFzYKn6cqUEbC7" name="Silver Spoons house" alt="A cast member riding the mini train through the house in Silver Spoons" src="https://cdn.mos.cms.futurecdn.net/vXcFuQUGDFzYKn6cqUEbC7.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="silver-spoons">Silver Spoons</h2><p>As a kid of the '80s, the Stratton's mansion on <em>Silver Spoons</em> is close to the top of my list of houses I wished I lived in. There was a train running through the living room, multiple arcade games, and a racing car bed! It's everything I ever wanted and more. Plus, we never got to see much other than a couple of rooms, there has to be so much to explore! </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="LoLN8mTgtzB6fD6BiwXEfe" name="Dynasty house" alt="The house in the opening montage of Dynasty" src="https://cdn.mos.cms.futurecdn.net/LoLN8mTgtzB6fD6BiwXEfe.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="dynasty">Dynasty</h2><p>The 1980s were a time when incredibly rich families stirred up melodrama among themselves on shows like <em>Dynasty</em>. Set in Denver, the show's family, the Carringtons, lived in an amazing home. The exteriors of the home were actually a palatial home in Pasadena called Arden Villa.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="FWByDBJB4xDZPCKz3YCENk" name="Modern Family  house" alt="Two kids standing by the pool in Modern Family" src="https://cdn.mos.cms.futurecdn.net/FWByDBJB4xDZPCKz3YCENk.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="modern-family">Modern Family</h2><p>Jay and Gloria Prichett's house on <em>Modern Family</em> fits the name of the show well. It's...well... modern and it's the kind of house I like to stalk on Zillow. It's not the most over-the-top, or biggest (nor the smallest, for sure), but it seems like a really awesome, realistic house that would be perfect for a week-long AirBnB rental. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="3HmbbscacrESKeBGazBniL" name="1618 Pine St., Boulder Colorado Mork & Mindy's House.jpg" alt="1618 Pine St., in Boulder Colorado on Mork & Mindy" src="https://cdn.mos.cms.futurecdn.net/3HmbbscacrESKeBGazBniL.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="mork-mindy">Mork & Mindy</h2><p>This is one of those homes on TV that actually seems like a place I could actually afford and live in. It's a simple house in Boulder, CO, where the show is set and while the prices all over Colorado for real estate are kind of insane, it's still a very cool looking, sensible house. Mork (Robin Williams) is the only thing that isn't sensible about it. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Gw8Cfjrgpn93ZRERmVjrfG" name="munsters house.jpg" alt="The Munsters at 1313 Mockingbird Lane" src="https://cdn.mos.cms.futurecdn.net/Gw8Cfjrgpn93ZRERmVjrfG.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Unversal)</span></figcaption></figure><h2 id="the-munsters">The Munsters</h2><p>There are few houses in TV history as iconic as the Munster's mansion from <em>The Munsters. </em>Though I'm not a big fan of horror movies, even I can appreciate all the Easter eggs and tributes to old monster movies that must be hidden all over the house. It's the kind of place that is a museum of the weird as much as it is a home. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="TzDN7LxZjia6i4nzZGXk36" name="The Brady Bunch house" alt="The living room in The Brady Bunch house." src="https://cdn.mos.cms.futurecdn.net/TzDN7LxZjia6i4nzZGXk36.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="the-brady-bunch">The Brady Bunch</h2><p>I love Mid-Century Modern architecture, especially houses. There is no better example of a cool Mid-Century Modern house in TV history than the house designed by Mike Brady on <em>The Brady Bunch</em>. It's also one of the rare shows where we basically see every room in the house in almost every episode. The one part we never see is where Alice lives, so that's something new to explore.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="f2SfHEXrjnQsTcadc5Urvh" name="little sven.png" alt="a visit from little sven the golden girls betty white casey sander" src="https://cdn.mos.cms.futurecdn.net/f2SfHEXrjnQsTcadc5Urvh.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="the-golden-girls">The Golden Girls</h2><p>I'm a total sucker for those weird Florida gated communities like the one in <em>The Golden Girls</em> and for that reason, I'd love to check the house shared by the four retired roommates in the classic NBC sitcom. It's not the most extravagant, nor the most interesting, but it's still the kind of realistic house I love. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="wcMqnrZvr5BUhUbfWFmNtB" name="The Sopranos house" alt="The Soprano family in the kitchen of their house on The Sopranos" src="https://cdn.mos.cms.futurecdn.net/wcMqnrZvr5BUhUbfWFmNtB.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO)</span></figcaption></figure><h2 id="the-sopranos">The Sopranos</h2><p>This is a little bit of an outlier because really, the house in <em>The Sopranos </em>is everything I kinda hate in a house. It's pretty much a standard suburban McMansion, so that means my exploration would really be to make fun of it. I get that it's not a great idea to criticize Carmela's decorating or Tony's house in general, but it's a risk I'd be willing to take. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="9sj4FcJjnb32sNNmxShCyK" name="Mad Men house" alt="A party scene in Don Draper's house in Mad Men" src="https://cdn.mos.cms.futurecdn.net/9sj4FcJjnb32sNNmxShCyK.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: AMC)</span></figcaption></figure><h2 id="mad-men">Mad Men</h2><p>Don Draper's apartment in <em>Mad Men</em> looks amazing. It's not the biggest home on this list, but it's so perfectly set in its time, it would be amazing to spend a few hours in listening to some jazz and smoking cigarettes. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="KBBCwRvhYBSatqwT8JnxfY" name="Dallas ranch" alt="An arial shot of Southfork Ranch in Dallas" src="https://cdn.mos.cms.futurecdn.net/KBBCwRvhYBSatqwT8JnxfY.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="dallas">Dallas</h2><p>Southfork Ranch is a real place. It's a popular spot in Dallas to hold weddings and other events. That means that exploring the house, which is home to the Ewing clan in <em>Dallas</em> is possible, but I'd want to go back in time and see it as it was when the Ewings lived there (on the show anyway). There would be so much to see across all of the property. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="8JidAsCDD4L6jjibnxMDof" name="The Simpsons house" alt="The exterior of The Simpsons house" src="https://cdn.mos.cms.futurecdn.net/8JidAsCDD4L6jjibnxMDof.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="the-simpsons">The Simpsons</h2><p>There are few addresses as famous as 742 Evergreen Terrace. It's not the grandest house on this list, obviously, but still, it's just so iconic. I can just see myself having a Duff on the back patio while Homer relaxes in his hammock, or lying on the floor with Lisa and Bart watching the latest episode of <em>Itchy & Scratchy</em>. Maybe even helping Marge in the kitchen cooking pork chops for dinner. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="XiVL8tyQ2oRisxjS4nW6Tm" name="Dexter apartment" alt="Michael C. Hall as Dexter walking outside of his apartment" src="https://cdn.mos.cms.futurecdn.net/XiVL8tyQ2oRisxjS4nW6Tm.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Showtime)</span></figcaption></figure><h2 id="dexter">Dexter</h2><p>Okay, I'll admit, this one is the most depraved choice on this list. Checking out Dexter's apartment from <em>Dexter</em> is sure to be disturbing and morbid, so it's the kind of place where it's good to keep in mind this is all fictional! Demented and sad, but fictional! </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="SQ8YBFpGKgKN6sgbAJdSCM" name="8-seinfeld-umbrella-twirl" alt="Seinfeld jerry does the umbrella twirl" src="https://cdn.mos.cms.futurecdn.net/SQ8YBFpGKgKN6sgbAJdSCM.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="seinfeld">Seinfeld</h2><p>Jerry's apartment on <em>Seinfeld</em> is probably the smallest home on this list. It's really just the kitchen and living room open-plan space (that <a href="https://www.cinemablend.com/television/2565703/seinfeld-apartment-impossible-shape">doesn't actually make sense</a>) and Jerry's bedroom, but there is always some cool stuff in the background, like Superman memorabilia and cereal boxes. Those are worth exploring, right? Maybe not, but Kramer may have the hot tub open in his apartment. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="8uUep59ChXYZTY7jDAbPm8" name="Screen Shot 2022-01-19 at 2.59.08 PM(1).jpg" alt="The Charmed cast" src="https://cdn.mos.cms.futurecdn.net/8uUep59ChXYZTY7jDAbPm8.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: The WB)</span></figcaption></figure><h2 id="charmed">Charmed</h2><p>Like a few others on this lit, visiting nd exploring the house on <em>Charmed</em> is less about the house - though it does look stunning - and more about learning about what is really going with these three witches. It has to be fascinating to see how they live when they aren't fighting demons and the like. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="afuNo5GGR8sWSviiH9hvzV" name="The Nanny Fran Drescher leans on a kitchen island while talking.jpg" alt="Fran Drescher leans on a kitchen island while talking in The Nanny." src="https://cdn.mos.cms.futurecdn.net/afuNo5GGR8sWSviiH9hvzV.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Tri-Star Television)</span></figcaption></figure><h2 id="the-nanny">The Nanny</h2><p>I'll admit I'm pretty fascinated by huge New York City apartments. It's just so different from how most people live in the city. The opulence and ease of living in multi-story dwellings in the city must be amazing, and the home on <em>The Nanny</em> certainly fits the bill like others on this list.  </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="fGxyWpxcA5WXo8wGM48RJ9" name="Desperate Housewives westeria" alt="The exterior of Wisteria Lane in Desperate Housewives" src="https://cdn.mos.cms.futurecdn.net/fGxyWpxcA5WXo8wGM48RJ9.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="desperate-housewives">Desperate Housewives</h2><p>This entry isn't about one house, it's about all the house and the neighborhood that makes up Wisteria Lane on <em>Desperate Housewives</em>. There isn't anything particularly special about any one house, but wow what a subdivision to live in! My suburban street was nothing like this... or maybe it was and I was just ignorant of it. Probably not. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="StFDgpyQGnrUAsBvQCTSSD" name="The Crown balmoral" alt="Balmoral Castle as shown in The Crown" src="https://cdn.mos.cms.futurecdn.net/StFDgpyQGnrUAsBvQCTSSD.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="the-crown">The Crown</h2><p>There are a lot of palaces and castles in Netflix's <em>The Crown</em> and all of them are real places, though none of the show was actually filmed in them, of course. Of all the castles and palaces that Queen Elizabeth is seen in on the show, the coolest and most interesting has to be Balmoral, her castle in Scotland where she ultimately died in real life. That's the castle and grounds I want to explore. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="yKevW2fPa2N2YKPEsTEFqW" name="Billions hamptons house" alt="The exterior of the house in the Hamptons in Billions" src="https://cdn.mos.cms.futurecdn.net/yKevW2fPa2N2YKPEsTEFqW.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Showtime)</span></figcaption></figure><h2 id="billions">Billions</h2><p>Even by TV show standards, Bobby Axelrod (Damien Lewis) on Showtime's <em>Billions </em>has a ridiculous beach house in the Hamptons. I mean, it looks like a country club clubhouse or a hotel, it's insane. It feels like you could spend a month there and never hang out in the same room twice. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="FJcDh4BmvDHXU9TMp9hfWo" name="Ozark house" alt="The exterior of the house in Ozark" src="https://cdn.mos.cms.futurecdn.net/FJcDh4BmvDHXU9TMp9hfWo.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="ozark">Ozark</h2><p>I've been to the Lake of the Ozarks a bunch of times in my life and while it's a super fun place, you don't really think of it as having interesting houses. On the show <em>Ozark, </em>the Byrdes definitely live in one that you wouldn't ever expect to see there, and it's based on a real place there. It's exactly the kind of house I love. It's also one of the few places that is actually based on a real thing at Lake of the Ozarks, as the show was primarily shot in Georgia. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="qpf3GY9iLGsZ5TM6bMCng6" name="Beverly Hills 90210 Walsh house" alt="The living of the Walsh house in Beverly Hills, 90210" src="https://cdn.mos.cms.futurecdn.net/qpf3GY9iLGsZ5TM6bMCng6.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="beverly-hills-90210">Beverly Hills, 90210</h2><p>As someone who grew up watching <em>Beverly Hills, 90210</em> every week, this is definitely a very personal choice. I just always thought the house was really nice looking and I'd love to spend some time hanging out with the Walshes. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Pz6jDigfZE8hsvAhuPhGbH" name="Arrested Development house" alt="Jason Bateman standing in the living room in the Arrested Development house." src="https://cdn.mos.cms.futurecdn.net/Pz6jDigfZE8hsvAhuPhGbH.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="arrested-development-2">Arrested Development</h2><p>Yes, it's only a model house, and yes, it's basically cheap construction of plywood and chewing gum, but still, the house in <em>Arrested Development</em> would be a wild place to hang out for a while. You could look for George in the attic, or count the number of blue handprints on the wall... there's just so much. I wouldn't mess around with the cornballer though. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="fX75knLrCWxryUifhvKXpH" name="Falcon Crest house" alt="The opening credits shot of the house in Falcon Crest" src="https://cdn.mos.cms.futurecdn.net/fX75knLrCWxryUifhvKXpH.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="falcon-crest">Falcon Crest</h2><p>One of the wildest wealthy fictional families on TV in the '80s was the Channing/Gioberti clan on <em>Falcon Crest. </em>It's a <a href="https://www.cinemablend.com/television/old-network-tv-shows-no-one-talks-about-enough">show that no one talks about anymore</a>, but the house, set in a fictionalized version of Napa Valley is <em>amazing</em> and really, we should be talking about it as the star of the show, though Jane Wyman is pretty fantastic on the show too. </p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ Full House’s Jodie Sweetin And Andrea Barber Get Real About The DJ Episode That Makes Them ‘Uncomfortable' ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/full-house-jodie-sweetin-andrea-barber-dj-episode-makes-them-uncomfortable</link>
                                                                            <description>
                            <![CDATA[ It was a hard episode to watch. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">9ZXtotmJZeCSnZ5Amfp3sa</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/sZ8XMGdYtJTdXhh4CLmThG-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Wed, 12 Feb 2025 03:40:41 +0000</pubDate>                                                                                                                                <updated>Wed, 12 Feb 2025 18:15:34 +0000</updated>
                                                                                                                                            <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Megan Behnke ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/FBUR6A5F9FTHQpVfjSuYpL.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Megan Behnke has been a Freelance TV News Writer at CinemaBlend since 2021. She has worked at multiple entertainment outlets, including as a Writer and Editor at Nerds and Beyond, TV and Movie News Writer at CBR, and a Freelance Writer at TV Fanatic, writing about topics she&#039;s passionate about like pop culture. She graduated from the University of Wisconsin Oshkosh with a degree in Multimedia Journalism in 2020, writing for the school’s newspaper during her time there. Her expertise in entertainment is mainly in television, but she has written about movies, music, and local events as well.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What They&#039;re Into&lt;/strong&gt;: Megan specializes in television writing, particularly procedurals. 9-1-1 and the Chicago Franchise are currently her favorites, where she can be found obsessively watching the latest episode or coming up with theories. She also loves to listen to music, with Taylor Swift being on the top of her playlist. She isn’t a huge sports person but will occasionally root for the Green Bay Packers, Milwaukee Brewers, and Wisconsin Badgers. As for movies, it’s hard to pick a favorite, but the Marvel Cinematic Universe reigns as her favorite franchise. She used to be a book nerd in grade school, with her favorite genre being fantasy or YA. Her favorite snack is sour cream and onion Pringles, while pizza is her all-time favorite food.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What They&#039;re Excited About Right Now&lt;/strong&gt;: Manifest Season 4 finally coming to Netflix, One Chicago, and Taylor Swift’s upcoming Midnights album, which will be on repeat.&lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/sZ8XMGdYtJTdXhh4CLmThG-1280-80.jpg">
                                                            <media:credit><![CDATA[Warner Bros.]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Jodie Sweetin as Stephanie Tanner and Candace Cameron Bure as DJ Tanner on Full House.]]></media:description>                                                            <media:text><![CDATA[Jodie Sweetin as Stephanie Tanner and Candace Cameron Bure as DJ Tanner on Full House.]]></media:text>
                                <media:title type="plain"><![CDATA[Jodie Sweetin as Stephanie Tanner and Candace Cameron Bure as DJ Tanner on Full House.]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/sZ8XMGdYtJTdXhh4CLmThG-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <iframe src="https://content.jwplatform.com/players/4Yh2VRSx.html" id="4Yh2VRSx" title="'Full House's' Jodie Sweetin Talks About 'Annoying' Candace Cameron Bure In Early Years, And I Kinda Need To Side With The Older Sister" width="600" height="338" frameborder="0" scrolling="auto" allowfullscreen></iframe><p><a href="https://www.cinemablend.com/television/candace-cameron-bure-watched-full-house-understand-whyshows-not-off-air-35-years"><em>Full House </em>has not been off the air for 35 years</a>, as it's lived on through syndication and streaming (with a <a href="https://www.cinemablend.com/television/2570432/subscribing-to-hbo-max-what-to-know-about-the-price-options-and-what-the-streaming-service-offers">Max subscription</a>) and remains a fan-favorite. With nearly 200 episodes under its belt, the <a href="https://www.cinemablend.com/television/home-improvement-patricia-richardson-real-about-series-legacy-throws-shade-full-house-tgif">classic TGIF sitcom</a> tackled quite a few socially relevant topics, including subject matter that was heavy for a comedy series. Andrea Barber and Jodie Sweetin have been digging into those subjects for their rewatch podcast, and they recently revealed a DJ Tanner episode that makes them "uncomfortable." </p><p>Barber and Sweetin, who played Kimmy Gibbler and Stephanie Tanner, respectively, on <em>Full House </em>and its Netflix revival, <em>Fuller House</em>, rewatched and discussed the Season 4 episode, “Shape Up." The installment sees DJ (Candace Cameron Bure) starving herself to look good for best friend Kimmy’s birthday pool party. During their podcast, <a href="https://open.spotify.com/episode/7xyvKPjbyggSzdifeN3pOs"><em>How Rude! Tanneritos</em></a>, the actress talked about the diet culture of the ‘90s. After Barber wondered if such an episode could be made today, Sweetin disagreed with that notion:</p><div><blockquote><p>I can’t imagine [this episode airing today]. There were definitely parts of it that made me uncomfortable or where we were — discussing young women’s bodies, frames, health, all of that. We definitely didn’t do anyone any favors.</p></blockquote></div><p>In the episode, DJ taped pictures of skinny models on the fridge, would only consume ice cube popsicles and gave her lunch to Kimmy and later Comet the dog. The teen even pushed herself so hard while working out that she collapsed in a gym. She was determined to have the perfect body for the pool party, despite the fact that she was perfectly healthy as is. Andrea Barber also didn't care for the episode:</p><div><blockquote><p>It was very uncomfortable to watch. It made me really feel for Candace, too, having to carry this storyline.</p></blockquote></div><p>The podcasters talked about how the storyline was about something that every teenage girl dealt with, which is why it was so visceral to watch. Both stars also seemed to be under the impression that the subject matter could've been handled with more nuance. On top of all that, Jodie Sweetin also recalled how Candace Cameron Bure was sensitive about her body in real life:</p><div><blockquote><p>‘Cause I know it was something [Candace] was sensitive about. It’s like, ‘Hey, we’re gonna make an entire storyline about the thing that you are the most [self-conscious about]’ … I really felt for her in this one, because it’s hard. It’s hard when it’s something that you’re really dealing with, to be like, ‘Oh, I’m going to pretend that this is fine, and I can resolve it.’</p></blockquote></div><p>The episode was resolved by the end, with Stephanie telling everyone what her older sister was doing and DJ having a talk with her father. It's interesting to think what it's like for a young actor to perform a "very special episode" like this one, and Andrea Barber went on to discuss how the Bure family felt beforehand:</p><div><blockquote><p>Well, I know that [creator] Jeff [Franklin] went to the Camerons. He went to the parents and Candace and said, ‘Is this OK?’ And they said yes, and they gave their blessing, but it doesn’t negate the fact that it’s a spotlight on a teenage girl and her insecurity.</p></blockquote></div><p>The classic ABC sitcom<em> </em>handled a range of heavy topics throughout its run, including drinking and smoking, with the weight storyline arguably being one of the more memorable episodes. Such a topic is tricky to tackle, and some may agree that it could've been handled better here. On that note, I can completely understand the discomfort that Andrea Barber and Jodie Sweetin had while watching.</p><p>Should another <a href="https://www.cinemablend.com/television/jodie-sweetin-has-idea-full-house-cast-should-do-another-series-i-dont-hate-it">another <em>FH </em>revival</a> happen, I don't imagine such a story would be produced. Though, if it did, I'd imagine the writers taking a deft approach and infusing the story with what we know about body positivity. If you'd like, you can check out the installment alongside the <a href="https://www.cinemablend.com/television/2553472/full-house-best-episodes-ranked">best <em>Full House </em>episodes</a> on Max. You can also grab a <a href="https://www.cinemablend.com/streaming-news/netflix-subscription-the-plans-the-price-and-whats-included">Netflix subscription</a> to stream Fuller House.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ John Stamos’ Sweet New Years Message Shouted Out His Full House Co-Star Amidst Cancer Battle, And Candace Cameron Bure Also Reached Out ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/john-stamos-sweet-new-years-message-shouted-full-house-co-star-cancer-battle-candace-cameron-bure-dave-coulier</link>
                                                                            <description>
                            <![CDATA[ Even Elvis would approve of this display of chosen family. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">VgFsU7k7cPEi5oBRLWh5p4</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/gB4gEscSVEWm7dYjHxUvwc-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Thu, 02 Jan 2025 17:17:12 +0000</pubDate>                                                                                                                                <updated>Thu, 02 Jan 2025 18:02:41 +0000</updated>
                                                                                                                                            <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Mike Reyes ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/fmM5xsfuCSo8rQBwh2pcX.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Mike Reyes is the Senior Movie Contributor at CinemaBlend, though that title’s more of a guideline really. Passionate about entertainment since grade school, the movies have always held a special place in his life, which explains his current occupation. Writing in some way, shape, or form since fifth grade, Mike’s time at CinemaBlend started in 2014, when he was hired as a freelance writer. In 2019, Mr. Reyes became a full time fixture of the CB staff, a decision that the management still hotly debates to this very day, questioning whether it was “a good idea, or the best idea?” Mike graduated from Drew University with a Bachelor’s Degree in Political Science, but swore off of running for public office a long time ago. You can hear him on various podcasts, you just need to know where to look.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Into&lt;/strong&gt;: This is a tough question to answer, as Mike’s kind of into a lot of things. Most prominently, he is CinemaBlend’s James Bond expert, thanks to being raised with a healthy appreciation for the storied spy series and anything espionage related. Mike has several other specialized fields that he’s been passionate about since his early years. Among those interests are breaking down the ins and outs of time travel, studying and admiring Large Scale Aggressors, Titans, Kaiju, and dinosaurs; as well as detective work. Adjacent to his entertainment interests, Mr. Reyes enjoys the worlds of high end mens fashion (eyewear included), fine alcohol and cocktails, and the comforts of a good book or video game. If you ask nicely, he might even dip back into his experience as a singer, just for fun.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Excited About Right Now&lt;/strong&gt;: The continuing hunt for the new James Bond, any and all updates about how Adam Wingard and Dan Stevens are turning Godzilla vs. Kong 2 into a stealth sequel to The Guest, and the potential for Tron: Ares to somehow be the sequel Tron: Ascension was promised to be. Also, a good excuse to be sent on another theme park assignment, and anything Guillermo del Toro has cooking,&lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/gB4gEscSVEWm7dYjHxUvwc-1280-80.jpg">
                                                            <media:credit><![CDATA[Max]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Jesse on piano in Full House]]></media:description>                                                            <media:text><![CDATA[Jesse on piano in Full House]]></media:text>
                                <media:title type="plain"><![CDATA[Jesse on piano in Full House]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/gB4gEscSVEWm7dYjHxUvwc-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>As we wait for <a href="https://www.cinemablend.com/television/2025-tv-premiere-date-schedule-upcoming-new-returning-shows"><u>2025 TV schedule</u></a> to truly kick off, now feels like a good time to get into some of those <a href="https://www.cinemablend.com/television/sitcoms-that-are-perfect-next-long-binge"><u>sitcoms perfect for long binges</u></a>. <em>Full House</em> feels like a no-brainer in that respect, as both fans and veterans of the ABC show continue to keep its legacy in mind rather fondly. Nowhere can that be better seen than in star John Stamos’ recent new years message, which saw him shout out co-star Dave Coulier, amidst his battle with cancer. </p><p>What’s more, fellow on-screen family member Candace Cameron Bure also reached out with her own best wishes for a happy and healthy road ahead. With Stamos taking to Instagram with a photo featuring his wife Caitlin McHugh and their son, the <em>Spidey and His Amazing Friends</em> star had this lengthy message of hope to share with the world: </p><div class="instagram-embed"><blockquote class="instagram-media"  data-instgrm-version="6" style="width:99.375%; width:-webkit-calc(100% - 2px); width:calc(100% - 2px);"><p><a href="https://www.instagram.com/p/DESk6kmvgXM/" target="_blank">A post shared by John Stamos (@johnstamos)</a></p><p>A photo posted by  on </p></blockquote></div><p>Even if you aren’t a fan of <em>Full House</em>, it’s a beautiful sight to see a sitcom family actually keep the love going long after they’ve wrapped on their roles. John Stamos has been showing that love ever since Dave Coulier’s cancer diagnosis became public; which inspired stunts both heartfelt and silly. </p><p>The latter part of the spectrum inspiring <a href="https://www.cinemablend.com/television/people-complained-john-stamos-wore-bald-cap-in-support-of-full-house-co-star-and-dave-coulier-response"><u>Stamos’ bald cap show of solidarity</u></a>, which cause a bit of a divide among the fans. What can’t be debated though are the <a href="https://cinemablend.com/television/see-john-stamos-candace-cameron-bure-lovely-messages-full-house-co-star-dave-coulier-cancer-battle"><u>continued well wishes from Coulier’s </u><u><em>Full House</em></u><u> family</u></a>. </p><p>Not only supporting the Canadian funny man during his time of need, folks like Candace Cameron Bure have shown love to John Stamos and others in the process. Looking through the comments of that post, you can see the former <em>Aurora Teagarden</em> star had a very special message for her other TV uncle: <em> </em></p><div><blockquote><p>Happy new year uncle J 🩷🎉love you!</p></blockquote></div><p>You don’t make one of the <a href="https://www.cinemablend.com/television/10-Greatest-TGIF-Comedies-All-Time-Ranked-120697.html"><u>greatest TGIF comedies of all time</u></a> by faking the energy needed to act like a family. That’s especially true when you take into account <em>Full House’s </em>initial eight season run, and <em>Fuller House’s</em> additional five seasons of wackiness on Netflix. The legacy cast of this legendary sitcom all love each other like an actual family, which only makes the enduring memory of such feats more powerful.</p><p>John Stamos, Candace Cameron Bure, and Dave Coulier are all headed into the new year with faith for better days ahead. And it’s hard not to want that for them, as reflecting their sitcom familial relations is as heartwarming as it was when they did it as the Tanners. </p><p>If you want to have a nice throwback marathon of <em>Full House</em>, you don’t need to believe in the milk man, the paper boy, or evening TV. Ok, maybe you need half of that last one, as using a <a href="https://www.cinemablend.com/television/2570432/subscribing-to-hbo-max-what-to-know-about-the-price-options-and-what-the-streaming-service-offers"><u>Max subscription</u></a> will allow you to revisit the Tanners everywhere you look for streaming entertainment. What time of day you decide to wood, er would, like to do so it totally up to you. </p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ Months After Full House’s Jodie Sweetin Recreated Stephanie Tanner’s Boyz II Men Dance In Viral Video, She Explained How She Totally Nailed It ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/after-full-houses-jodie-sweetin-recreated-stephanie-tanners-boyz-ii-men-dance-explained-how-she-nailed-it</link>
                                                                            <description>
                            <![CDATA[ It's like no time had passed. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">gYQfFH3ELzxUPbXcguev9X</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/Q8ods3L76HTaDmZxz4n7mU-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Wed, 01 Jan 2025 03:10:00 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Megan Behnke ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/FBUR6A5F9FTHQpVfjSuYpL.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Megan Behnke has been a Freelance TV News Writer at CinemaBlend since 2021. She has worked at multiple entertainment outlets, including as a Writer and Editor at Nerds and Beyond, TV and Movie News Writer at CBR, and a Freelance Writer at TV Fanatic, writing about topics she&#039;s passionate about like pop culture. She graduated from the University of Wisconsin Oshkosh with a degree in Multimedia Journalism in 2020, writing for the school’s newspaper during her time there. Her expertise in entertainment is mainly in television, but she has written about movies, music, and local events as well.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What They&#039;re Into&lt;/strong&gt;: Megan specializes in television writing, particularly procedurals. 9-1-1 and the Chicago Franchise are currently her favorites, where she can be found obsessively watching the latest episode or coming up with theories. She also loves to listen to music, with Taylor Swift being on the top of her playlist. She isn’t a huge sports person but will occasionally root for the Green Bay Packers, Milwaukee Brewers, and Wisconsin Badgers. As for movies, it’s hard to pick a favorite, but the Marvel Cinematic Universe reigns as her favorite franchise. She used to be a book nerd in grade school, with her favorite genre being fantasy or YA. Her favorite snack is sour cream and onion Pringles, while pizza is her all-time favorite food.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What They&#039;re Excited About Right Now&lt;/strong&gt;: Manifest Season 4 finally coming to Netflix, One Chicago, and Taylor Swift’s upcoming Midnights album, which will be on repeat.&lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/Q8ods3L76HTaDmZxz4n7mU-1280-80.jpg">
                                                            <media:credit><![CDATA[Max]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Stephanie getting ready to dance on Full House.]]></media:description>                                                            <media:text><![CDATA[Stephanie getting ready to dance on Full House.]]></media:text>
                                <media:title type="plain"><![CDATA[Stephanie getting ready to dance on Full House.]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/Q8ods3L76HTaDmZxz4n7mU-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p><em>Full House </em>remains a favorite among fans even almost 30 years after it ended, partly because of its easy availability streaming with a <a href="https://www.cinemablend.com/television/2570432/subscribing-to-hbo-max-what-to-know-about-the-price-options-and-what-the-streaming-service-offers">Max subscription</a>. There are memorable moments from the TGIF sitcom that are still talked about, including Stephanie’s “Motown Philly” dance in the Season 5 episode “Gotta Dance.” <a href="https://www.cinemablend.com/television/full-house-jodie-sweetin-reenacted-stephanie-viral-dance-nostalgia-real">Jodie Sweetin recreated her character’s dance</a> back in August, and now she finally opened up about nailing it after all these years.</p><p>In the episode, Stephanie talked Danny into letting her take dance classes, which wound up taking up much of her time and she didn’t realize it until D.J. told her if she had her discipline and dedication, she’d have no life. Not wanting to take the class anymore and put her relationships first, Stephanie purposely messed up the dance during the recital but after a talk with Danny, she apologized to her fellow dancers. They went back out and absolutely killed the Boyz II Men song. </p><p>33 years later, Sweetin and artist Mitchell Gerrard Johnson recreated the viral dance, complete with matching outfits, and they got quite a lot of praise. Take a look, if you missed it over the summer:</p><div class="instagram-embed"><blockquote class="instagram-media"  data-instgrm-version="6" style="width:99.375%; width:-webkit-calc(100% - 2px); width:calc(100% - 2px);"><p><a href="https://www.instagram.com/p/C-pd0EIJgI0/" target="_blank">A post shared by Mitchell Gerrard Johnson ⚡️ (@mgjohns)</a></p><p>A photo posted by  on </p></blockquote></div><p>Considering a lot of time has passed, it was certainly impressive that Sweetin was able to do the dance pretty perfectly. I was impressed with just little Sweetin nailing the dance all those years ago; doing it again years later is pretty great and a fun <a href="https://www.cinemablend.com/television/john-stamos-shared-adorable-throwback-full-house-olsen-twins-cast-jodie-sweetin-response"><em>Full House </em>throwback</a>. The actress spoke to <a href="https://people.com/jodie-sweetin-talks-nailing-the-full-house-stephanie-tanner-dance-again-exclusive-8749808"><em>PEOPLE</em></a><em> </em>about recreating the dance and the process, and it’s almost as if the routine never left her:</p><div><blockquote><p>Mitchell — who's the dancer that does all of these great recreate videos — he and I met up, and I'd been watching the video at home just so I could kind of, you know, go back. Weirdly, I was like, 'Oh, right. That!' It was like in my body. By the time we got to the studio and started doing it, I actually knew the whole thing and he had only done like the first two eight-counts. And he was like, 'Wait, you learned the whole thing?'</p></blockquote></div><p>Props to Sweetin for managing to do the dance perfectly and to look good while doing it. It’s unknown if she will be recreating any more dances or scenes from <em>Full House </em>or <em>Fuller House</em>, but it’s clear that it’s a quick study for her if she'd known the steps way back when. </p><p>This isn’t the first dance of Stephanie’s that was recreated and it hopefully won’t be the last since the middle Tanner sister was quite the little dancer. And for Sweetin, it seems like all it takes is for her to rewatch a video and practice it a few times in order to nail it. There was a <a href="https://www.cinemablend.com/television/2547793/fuller-house-all-the-biggest-full-house-callbacks-from-the-final-netflix-episodes">great callback to <em>Full House </em>in <em>Fuller House</em></a><em> </em>when Jimmy Gilbert did the infamous “Love Shack” dance from Season 3’s “Our Very First Telethon,” complete with the outfit. It just shows how iconic Stephanie Tanner was and is and how she will always have an impact on Jodie Sweetin.</p><p><em>Full House </em>is <a href="https://www.cinemablend.com/television/sitcoms-that-are-perfect-next-long-binge">perfect for your next long-binge</a> and there’s a <a href="https://www.cinemablend.com/television/candace-cameron-bure-watched-full-house-understand-whyshows-not-off-air-35-years">reason it hasn’t been off the air in 35 years</a>. The show is still beloved by many, and much of the cast is still close. I can’t wait to see what other memorable moments are hopefully recreated in the future.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ 32 TV Show Retcons That Left Us Confused ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/tv-show-retcons-left-us-confused</link>
                                                                            <description>
                            <![CDATA[ Wait, that's not how I remember this show... ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">2QjyBxdVKAroVHFxqwnXoS</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/iuJqYn4RLj4oWUbtNWNsa-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Thu, 26 Dec 2024 20:33:00 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Jason Wiese ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/62SRu9Bi2SyJGrpzKXAfsK.jpg ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Jason Wiese writes feature stories for CinemaBlend. His occupation results from years dreaming of a filmmaking career, settling on a &quot;professional film fan&quot; career, studying journalism at Lindenwood University in St. Charles, MO (where he served as Culture Editor for its student-run print and online publications), and a brief stint of reviewing movies for fun. He would later continue that side-hustle of film criticism on TikTok (@wiesewisdom), where he posts videos on a semi-weekly basis.&lt;/p&gt;&lt;p&gt;&lt;br&gt;&lt;/p&gt;&lt;p&gt;Jason has been writing since he was able to pick up a washable marker, with which he wrote his debut illustrated children&#039;s story, later transitioning to a short-lived comic book series and (very) amateur filmmaking before finally settling on pursuing a career in writing about movies in lieu of making them. Look for his name in almost any article about Batman.&lt;/p&gt;&lt;p&gt;&lt;br&gt;&lt;/p&gt;&lt;p&gt;&lt;strong&gt;What He&#039;s Into&lt;/strong&gt;: Readers may notice a recurring theme of horror and superhero-related content (especially in regards to Batman) in much of Jason&#039;s work, but his favorite film of all time is more in line with traditional action/adventure stories: &lt;em&gt;Raiders of the Lost Ark&lt;/em&gt;. His favorite TV series is the gritty, grounded crime thriller &lt;em&gt;Breaking Bad&lt;/em&gt; and if you catching him reading anything, it is probably a comic book (and, more often than not, one featuring Batman). More important to him than entertainment, however, are his wife and two dogs.&lt;/p&gt;&lt;p&gt;&lt;br&gt;&lt;/p&gt;&lt;p&gt;&lt;strong&gt;What He&#039;s Excited About Right Now&lt;/strong&gt;: Jason typically tries to keep his excitement and expectations for any upcoming movies as low as possible, but he is certainly looking forward to returning to Matt Reeves&#039; vision of Gotham City in the upcoming follow-up to &lt;em&gt;The Batman&lt;/em&gt; and just about any horror movie set to haunt cinemas soon.&lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/iuJqYn4RLj4oWUbtNWNsa-1280-80.jpg">
                                                            <media:credit><![CDATA[NBC]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Matthew Perry as Chandler looking concerned on Friends]]></media:description>                                                            <media:text><![CDATA[Matthew Perry as Chandler looking concerned on Friends]]></media:text>
                                <media:title type="plain"><![CDATA[Matthew Perry as Chandler looking concerned on Friends]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/iuJqYn4RLj4oWUbtNWNsa-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>Is there a single TV show that, for the entirety of its run, managed to keep its story going without any retcons? For one reason or another, it is common to see a popular series amend or completely disregard a pre-established story or character detail, often leading fans to wonder if they are losing their minds. Don't worry: you're not crazy but merely a victim of some confusing or even just annoying TV retcons like the following.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="H9UhZbLJXtJuXjdKRp63HE" name="Boy Meets World Cory And Topanga Wedding.jpg" alt="Cory and Topanga getting married on Boy Meets World." src="https://cdn.mos.cms.futurecdn.net/H9UhZbLJXtJuXjdKRp63HE.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC/Disney+)</span></figcaption></figure><h2 id="cory-and-topanga-s-origins-boy-meets-world">Cory And Topanga's Origins (Boy Meets World)</h2><p>The romance between Cory Matthews (Ben Savage) and Topanga Lawrence (Danielle Fishel) could have been the perfect sitcom love story if the <a href="https://www.cinemablend.com/television/10-Greatest-TGIF-Comedies-All-Time-Ranked-120697.html">classic TGIF comedy</a> could keep the details of their relationship straight. When Fishel first joined the <a href="https://www.cinemablend.com/television/2567022/what-the-boy-meets-world-cast-is-up-to-now"><em>Boy Meets World</em> cast</a>, she was initially introduced as the weird student in Cory's elementary school class but, when she is later reinvented as his love interest, the show tries to play them off as sweethearts since childhood.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="ae3v8qGNHUkcEArrKvkf6M" name="the conners.jpg" alt="Dan at dinner table in kitchen on The Conners" src="https://cdn.mos.cms.futurecdn.net/ae3v8qGNHUkcEArrKvkf6M.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="dan-is-alive-roseanne">Dan Is Alive (Roseanne)</h2><p>Not only is Season 9 of <em>Roseanne</em>, in which the Conners' lives change when they win the lottery, revealed to be a fantasy in the series finale but we also learn that Dan (John Goodman) was dead the entire time, having suffered a heart attack. This controversial plot twist was ignored in 2018 when the sitcom was revived for a tenth season before it was rebranded as <em>The Conners</em>.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="GeWdZe2VAWKLe6bNKunFfd" name="Screen Shot 2023-09-07 at 11.37.13 AM.jpg" alt="John Mahoney as Martin Crane on Frasier" src="https://cdn.mos.cms.futurecdn.net/GeWdZe2VAWKLe6bNKunFfd.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Paramount Television)</span></figcaption></figure><h2 id="the-fate-of-frasier-s-father-cheers-frasier">The Fate Of Frasier's Father (Cheers/Frasier)</h2><p>On one episode of <em>Cheers</em>, Frasier Crane (Kelsey Grammer) tells his friends at the bar that his late father was a research scientist. However, in Frasier's self-titled and <a href="https://www.cinemablend.com/television/tv-spin-offs-that-were-as-good-or-better-than-the-show-they-came-from">equally beloved TV show spin-off</a>, we see Martin Crane (John Mahoney) is alive and well and a retired cop. In an episode where Ted Danson appears as Sam Malone, the show tries to explain that Frasier's dad was "dead to him" at the time after a bitter argument.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="fH9KwYdLZGNTPn4DW9zDMh" name="prisonbreaksarahwaynecallies" alt="Sarah Wayne Callies as Sara crying on Prison Break" src="https://cdn.mos.cms.futurecdn.net/fH9KwYdLZGNTPn4DW9zDMh.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="sara-was-not-dead-after-all-prison-break">Sara Was Not Dead After All (Prison Break)</h2><p>In the third season of <em>Prison Break</em>, Michael (Wentworth Miller) learns that Sara (Sarah Wayne Callies) was kidnapped and beheaded, only to see her come back in Season 4, which reveals it was never actually her head. In reality, the reason for the character's demise was due to a dispute involving Callies' contract but, when she was able to work out a deal to return to the series, her earlier death was rewritten as a <em>head</em> fake.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="JeeUdshuGQe8s25ejbDHeP" name="smallvilleaaronashmore" alt="Aaron Ashmore as Jimmy Olsen smiling on Smallville" src="https://cdn.mos.cms.futurecdn.net/JeeUdshuGQe8s25ejbDHeP.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros. / DC)</span></figcaption></figure><h2 id="jimmy-olsen-was-not-who-we-thought-he-was-smallville">Jimmy Olsen Was Not Who We Thought He Was (Smallville)</h2><p>In its sixth season, the <a href="https://www.cinemablend.com/television/2469836/the-10-best-dc-superhero-shows-of-the-modern-era-according-to-rotten-tomatoes">acclaimed DC TV show</a> <em>Smallville</em> introduced the iconic character of photographer Jimmy Olsen (Aaron Ashmore), only to kill him off three years later. It is at his funeral that we learn that his real name is Henry James Olsen and that the real Jimmy Olsen was his never-before-seen little brother the whole time.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="BSsgZ6Jm2oMSTwiATESVba" name="seinfeldmichaelrichardsbobsacamano.jpg" alt="Michael Richards on Seinfeld" src="https://cdn.mos.cms.futurecdn.net/BSsgZ6Jm2oMSTwiATESVba.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="kramer-was-originally-named-kessler-seinfeld">Kramer Was Originally Named Kessler (Seinfeld)</h2><p>In the pilot episode of <em>Seinfeld</em>, Jerry (Jerry Seinfeld) calls his next-door neighbor by the name Kessler but, from the next episode on, Michael Richards' character is referred to as Kramer, after Larry David's real-life friend on whom the role is based. The series tries to explain this in Season 9's "The Betrayal" with a flashback to the characters' first meeting when Kramer tells Jerry that the name on his buzzer is incorrect.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="qtcuKSg2CYiVgjhpfoKCpK" name="bobbyewingshowerrevealdallas" alt="Bobby Ewing alive shower reveal on Dallas" src="https://cdn.mos.cms.futurecdn.net/qtcuKSg2CYiVgjhpfoKCpK.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="bobby-s-death-was-all-a-dream-dallas">Bobby's Death Was All A Dream (Dallas)</h2><p>When Patrick Duffy decided to quit the CBS primetime soap opera, <em>Dallas</em>, his character, Bobby Ewing, was written off the show in Season 8 when he was run over by his sister-in-law, Katherine Wentworth (Morgan Brittany), and was buried after succumbing to his injuries in the Season 9 premiere. However, after the writers urged the actor to come back to the cast, the Season 10 opener revealed everything that happened in the previous season was imagined by his wife, Pamela Barnes Ewing (Victoria Principal), in her sleep.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="3cNGfxkPZkuqmqB98Pp8cn" name="1315447 (1).jpg" alt="Penn Badgley in Gossip Girl." src="https://cdn.mos.cms.futurecdn.net/3cNGfxkPZkuqmqB98Pp8cn.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: The CW)</span></figcaption></figure><h2 id="gossip-girl-s-true-identity-does-not-make-sense-gossip-girl">Gossip Girl's True Identity Does Not Make Sense (Gossip Girl)</h2><p>As revealed in the <a href="https://www.cinemablend.com/television/2553000/gossip-girl-endinghow-things-wrapped-up-for-each-main-character">series finale of <em>Gossip Girl</em></a>, Dan Humphrey (Penn Badgley) was the mysterious blogger the entire time but, if that's true, why does he act surprised by several posts about him, his friends, and his relatives in earlier episodes? Furthermore, Gossip Girl publicizes the fact that Dan and his girlfriend, Serena van der Woodsen (Blake Lively), share a half-sibling, which he adamantly wants kept secret. So, why on Earth would he make that public, even anonymously?</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="QVHM9zkMRfaoGUD43PFXn5" name="Family Matters Judy.jpg" alt="Jaimee Foxworth on Family Matters" src="https://cdn.mos.cms.futurecdn.net/QVHM9zkMRfaoGUD43PFXn5.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="what-ever-happened-to-judy-winslow-family-matters">What Ever Happened To Judy Winslow (Family Matters)</h2><p>YouTuber <a href="https://www.youtube.com/watch?v=zMAbajvYLWY">Vee Infuso</a> debunked an urban legend believing that the youngest Winslow child, Judy, once walked up the stairs in a Season 4 episode never to be seen again. While Jaimee Foxworth's actual final appearance in the <a href="https://www.cinemablend.com/television/what-the-family-matters-cast-is-doing-now"><em>Family Matter</em> cast</a> came later that season in "Mama's Wedding," her subsequent absence (due to the <a href="https://www.cinemablend.com/television/why-family-matters-judy-winslow-was-dropped-from-the-tgif-show">writers having nothing interesting to come up with for her</a>) was never explained nor acknowledged for the remainder of the series.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="PQK2NiiSDZXJVLncSKuXzR" name="Friends Thanksgiving Episodes-1.jpg" alt="Courteney Cox and Matthew Perry in Friends" src="https://cdn.mos.cms.futurecdn.net/PQK2NiiSDZXJVLncSKuXzR.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="the-first-time-chandler-said-i-love-you-to-monica-friends">The First Time Chandler Said "I Love You" To Monica (Friends)</h2><p>In one of the <a href="https://www.cinemablend.com/television/most-ridiculous-friends-episodes">most ridiculous <em>Friends</em> episodes</a>, "The One Where Everyone Finds Out," Chandler (Matthew Perry) is coerced by Phoebe's (Lisa Kudrow) feigned seduction into admitting that he is in love with Monica (Courteney Cox) to everyone's surprise, including her own. However, the otherwise touching moment seems to forget about an earlier <a href="https://www.cinemablend.com/television/2558723/every-friends-thanksgiving-episode-ranked"><em>Friends</em> Thanksgiving episode</a>, "The One With All The Thanksgivings," in which Chandler lets his feelings for Monica slip when she surprises him with a turkey on her head.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="YK27BsU39u9pMYhkHzsmE8" name="Doctor Who David Tennant" alt="David Tennant's Tenth Doctor seeing Madame de Pompadour as an adult" src="https://cdn.mos.cms.futurecdn.net/YK27BsU39u9pMYhkHzsmE8.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: BBC)</span></figcaption></figure><h2 id="a-time-lord-s-maximum-number-of-regenerations-changes-doctor-who">A Time Lord's Maximum Number Of Regenerations Changes (Doctor Who)</h2><p>Early on in the long-running, <a href="https://www.cinemablend.com/television/2492644/the-best-sci-fi-tv-shows-available-to-stream-now">classic sci-fi TV show</a>'s history, it is established that the title character of <em>Doctor Who</em>, like all Time Lords, can only regenerate a total of 13 times. However, that rule has since been negated as the 13th Doctor actor, Jodie Whitaker, was later replaced by Ncuti Gatwa.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="wUnEfj8LJiK2d9CwPZjWGT" name="arrow oliver" alt="Screenshot of Oliver Queen close-up with arrow quill in Arrow" src="https://cdn.mos.cms.futurecdn.net/wUnEfj8LJiK2d9CwPZjWGT.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="the-history-of-superheroes-dates-back-longer-than-we-thought-arrowverse">The History Of Superheroes Dates Back Longer Than We Thought (Arrowverse)</h2><p>After adopting his vigilante alter ego at the beginning of the hit series, <em>Arrow</em>, Oliver Queen (Stephen Amell) is said to have become the first superhero. Yet, later down the road as the Arrowverse franchise would continue to evolve with its multiple spin-offs, it was discovered that superhero teams have existed as early as World War II.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="aRAf4SbEZeTXvMK7mHoDe8" name="fullhouseandreabarber.jpg" alt="Andrea Barber on Full House" src="https://cdn.mos.cms.futurecdn.net/aRAf4SbEZeTXvMK7mHoDe8.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="kimmy-gibbler-s-sibling-count-full-house-fuller-house">Kimmy Gibbler's Sibling Count (Full House/Fuller House)</h2><p>When Kimmy Gibbler is first mentioned in the 1987 pilot for <em>Full House</em>, D.J. Tanner (Candace Cameron Bure) says she has three sisters but the character (played by Andrea Barber) says in Season 3 that her parents stopped having kids after her. This could imply she is merely the youngest in her family but she was also known to mention having an unseen older brother named Garth. Furthermore, in Netflix's revival, <em>Fuller House</em>, we are introduced to her <em>younger</em> brother, Jimmy (Adam Hagenbuch).</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="M3z33FHb2ijDpmnX3ESjpb" name="gilmoregirlsdean" alt="Jared Padalecki as Dean at movie night on Gilmore Girls" src="https://cdn.mos.cms.futurecdn.net/M3z33FHb2ijDpmnX3ESjpb.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros.)</span></figcaption></figure><h2 id="dean-loses-his-urban-philosophy-gilmore-girls">Dean Loses His Urban Philosophy (Gilmore Girls)</h2><p>When Jared Padalecki first joined the <a href="https://www.cinemablend.com/television/2494805/gilmore-girls-careers-that-took-off-after-the-drama-series-aired"><em>Gilmore Girls</em> cast</a> as Dean, the character was introduced as a Chicago native who had moved to Stars Hollow fairly recently and loves obscure books and movies. However, when New York transplant and obscure book and movie lover Jess (Milo Ventimiglia) is brought into the mix, Dean is suddenly reinvented as a more rural individual who has lost his cultural interests and thinks of Stars Hollow as his true home after living "most of his life" there.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="9budvXsgqmDMmjKDGpooZ4" name="that70sshowtina" alt="Amanda Fuller as Tina Pinciotti smiling on That '70s Show" src="https://cdn.mos.cms.futurecdn.net/9budvXsgqmDMmjKDGpooZ4.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="the-disappearance-of-donna-s-sister-that-70s-show">The Disappearance Of Donna's Sister (That '70s Show)</h2><p>We are willing to bet that, even if you considered yourself a huge <em>That '70s Show</em> fan, you had absolutely no recollection that Donna (Laura Prepon) had a sister. Tina Pinciotti (Amanda Fuller) makes one appearance in Season 1 and is subsequently mentioned only once more in a throwaway joke from Season 2's "Vanstock" but, from that point on, Donna is referred to as an only child.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="KNzzH7mvandnxG4BCRw68C" name="gameofthronesfinaledanyspeech" alt="Emilia Clarke as Dany giving speech in Game of Thrones series finale" src="https://cdn.mos.cms.futurecdn.net/KNzzH7mvandnxG4BCRw68C.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO)</span></figcaption></figure><h2 id="daenerys-goes-bad-game-of-thrones">Daenerys Goes Bad (Game Of Thrones)</h2><p>Here is an example of something that is not so much a retcon but a deeply confusing and quite maddening <a href="https://www.cinemablend.com/movies/movie-and-tv-characters-who-experienced-an-extreme-personality-change">TV character evolution</a> that suddenly comes out of nowhere. One of the most heavily <a href="https://www.cinemablend.com/television/2471715/6-criticisms-of-game-of-thrones-season-8">criticized aspects of the eighth and final season of <em>Game of Thrones</em></a> sees the normally level-headed and fair Daenerys (Emilia Clarke) become a coldhearted tyrant who commits unimaginably brutal crimes without a second's hesitation.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="v4BMkPn3Y9M5TYoibFBeH4" name="6-strangers:river copy.jpg" alt="madelaine petsch in riverdale" src="https://cdn.mos.cms.futurecdn.net/v4BMkPn3Y9M5TYoibFBeH4.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CW)</span></figcaption></figure><h2 id="are-jason-and-cheryl-really-twins-riverdale">Are Jason And Cheryl Really Twins? (Riverdale)</h2><p>There are a number of notable inconsistencies regarding the characters in the <a href="https://www.cinemablend.com/television/2561171/where-youve-seen-the-riverdale-cast-before"><em>Riverdale</em> cast</a>, but one of the more glaring involves Cheryl Blossom (Madelaine Petsch) and her brother, Jason (Trevor Stines). While initially established as fraternal twins, later episodes of the Archie Comics-inspired dramedy imply that they are in two different grade levels at school.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="oVAGLJZhBmfbVtxzAnjCnc" name="Buffy the Vampire Slayer S6 Ep3A.jpg" alt="James Marsters in Buffy" src="https://cdn.mos.cms.futurecdn.net/oVAGLJZhBmfbVtxzAnjCnc.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: 20th Century Fox Television )</span></figcaption></figure><h2 id="who-made-spike-a-vampire-buffy-the-vampire-slayer">Who Made Spike A Vampire? (Buffy The Vampire Slayer)</h2><p>A lot of <em>Buffy the Vampire Slayer</em> fans like to count the sudden appearance of Buffy's never-before-seen younger sister Dawn (Michelle Trachtenberg) as a retcon. However, the sentient form of power's inclusion is explained by fake memories implanted into the characters' minds after she is sent to Buffy (Sarah Michelle Gellar) to protect, so we are not counting that. Instead, we will mention how Spike (James Marsters) refers to Angel (David Boreanaz) as the vampire who turned him until it is later revealed that Drusilla is his true sire.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Wa5msRVzx49hWsLp665cMD" name="bigbangknock" alt="Jim Parsons as Sheldon knocking on Penny's door on The Big Bang Theory" src="https://cdn.mos.cms.futurecdn.net/Wa5msRVzx49hWsLp665cMD.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros.)</span></figcaption></figure><h2 id="why-sheldon-knocks-multiple-times-the-big-bang-theory">Why Sheldon Knocks Multiple Times (The Big Bang Theory)</h2><p>One of the most iconic running gags on <em>The Big Bang Theory</em> is Sheldon Cooper's (Jim Parsons) compulsion to knock on people's doors three times, which was only first introduced in Season 2. However, in Season 10, he explains that he formed the habit after accidentally walking in on his father having an affair and wants to give people enough time to "get their pants on" with his courteous and incessant signal.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="duvSpFRLLnqqEe28kPHsvL" name="HeroesHayden.png" alt="Hayden Panettiere in Season 2 of Heroes" src="https://cdn.mos.cms.futurecdn.net/duvSpFRLLnqqEe28kPHsvL.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="when-claire-gets-her-powers-heroes">When Claire Gets Her Powers (Heroes)</h2><p>In the first season of <em>Heroes</em>, it is established that Claire Bennet (Hayden Panettiere) developed her rapid healing ability later in life when she hit puberty. However, in a later episode when she meets her birth mother, it is revealed that she was indestructible even when she was an infant.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Litop9sGPrwqsJKfndv6yW" name="supernatural300deansam" alt="Jensen Ackles and Jared Padalecki in Supernatural's 300th episode" src="https://cdn.mos.cms.futurecdn.net/Litop9sGPrwqsJKfndv6yW.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: The CW)</span></figcaption></figure><h2 id="the-rules-of-being-a-vessel-are-inconsistent-supernatural">The Rules Of Being A Vessel Are Inconsistent (Supernatural)</h2><p>At one point in the 15-season run of <em>Supernatural</em>, it is established that being a vessel for a spiritual entity will result in the host's death once the entity no longer requires their physical form. However, Sam (Jared Padalecki), Dean (Jensen Ackles), and even the Lucifer-possessed President Jefferson Rooney (David Chisum) end up just fine after their time as a vessel ends.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="y5Bt3dxrN5W2igbFwW3X7e" name="gleetina" alt="Jenna Ushkowitz sitting during glee club on Glee" src="https://cdn.mos.cms.futurecdn.net/y5Bt3dxrN5W2igbFwW3X7e.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="tina-admits-she-was-faking-her-stutter-glee">Tina Admits She Was Faking Her Stutter (Glee)</h2><p>When Tina (Jenna Ushkowitz) is first introduced in the first season of <em>Glee</em>, she speaks with a stutter that suddenly disappears after she joins the glee club. She eventually reveals she faked it hoping that it would make Artie Abrams (Kevin McHale) like her more.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="iCRxqFvSDxPpA9p7byq4rN" name="monkjasongraystanford.jpg" alt="Jason Gray-Stanford on Monk" src="https://cdn.mos.cms.futurecdn.net/iCRxqFvSDxPpA9p7byq4rN.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: USA)</span></figcaption></figure><h2 id="randy-suddenly-gains-an-uncle-monk">Randy Suddenly Gains An Uncle (Monk)</h2><p>Even a detective show as clever as <em>Monk</em> has been known to make a few logical errors from time to time. For instance, Lt. Randy Disher (Jason Gray-Stanford) says at one point that he has two aunts but no uncles but, in the Season 5 episode "Mr. Monk Visits a Farm," he inherits land from a recently deceased family member... his uncle, Harvey (Jack Kehler).</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="GwZuJvzTJQxUNVdYwaDtgm" name="MV5BMjg2MTQ5OTctNWZkMi00MTdhLWI3MDctYWQ1NjhkOTI1YmJmXkEyXkFqcGdeQXVyMDgyNjA5MA@@._V1_.jpg" alt="The West Wing" src="https://cdn.mos.cms.futurecdn.net/GwZuJvzTJQxUNVdYwaDtgm.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="president-barlett-s-death-tax-repeal-veto-is-a-surprise-the-west-wing">President Barlett's Death Tax Repeal Veto Is A Surprise (The West Wing)</h2><p>In Season 2 of creator Aaron Sorkin's <em>The West Wing</em>, it is mentioned by political commentator Mark Gottfried (Ted McGinley) that President Josiah Bartlett (Martin Sheen) vetoed a Republican-backed education package. However, in the following season when he vetoes a repeal of the "death tax," it causes an uproar as people claim he had never used the veto before.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="MZkr4guMYknuNpHnQmuSGL" name="himymbarneydriving" alt="Neil Patrick Harris as Barney pulled over by a cop on How I Met Your Mother" src="https://cdn.mos.cms.futurecdn.net/MZkr4guMYknuNpHnQmuSGL.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="barney-suddenly-knows-how-to-drive-how-i-met-your-mother">Barney Suddenly Knows How To Drive (How I Met Your Mother)</h2><p>In Season 2 of <em>How I Met Your Mother</em>, we discover that Barney Stinson (Neil Patrick Harris) not only does not know how to drive a car but is absolutely terrified to get behind the wheel. Yet, two seasons later, in one of the <a href="https://www.cinemablend.com/television/the-best-how-i-met-your-mother-episodes-ranked">best <em>HIMYM</em> episodes</a>, "As Fast as She Can," he makes multiple attempts to get a speeding ticket to prove he can talk his way out of one and is also seen driving plenty of times afterward. Perhaps he could have worked up the courage to finally learn how to drive by then but there is absolutely no mention of it, making his sudden acquirement of this skill a bit sudden.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="MYjTzvBEoUSRScb3fuiak4" name="moriarty sherlock.png" alt="Andrew Scott in Sherlock." src="https://cdn.mos.cms.futurecdn.net/MYjTzvBEoUSRScb3fuiak4.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: BBC One)</span></figcaption></figure><h2 id="fans-still-missed-moriarty-sherlock">Fans Still Missed Moriarty (Sherlock)</h2><p>At the end of <em>Sherlock</em>'s third season, a message from the detective's archnemesis, Moriarty (Andrew Scott) suggested the criminal mastermind would play a pivotal role in the following season. Unfortunately, fans would discover that he had no involvement in Season 4, which is less of a retcon and more of an infuriating cop-out.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="pY4SGjbY7yqhnDpCXMyRh4" name="RickTWDS2.jpg" alt="Rick in Season 2 of TWD after zombie Sophia walked out of the barn" src="https://cdn.mos.cms.futurecdn.net/pY4SGjbY7yqhnDpCXMyRh4.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: AMC)</span></figcaption></figure><h2 id="walker-blood-is-not-a-source-of-infection-the-walking-dead">Walker Blood Is Not A Source Of Infection (The Walking Dead)</h2><p>Early seasons of <em>The Walking Dead</em> established that getting blood from one of the undead in your eyes or mouth or in a wound would prove fatal, yet later seasons ignore this rule almost completely. This retcon goes further than just the TV series as it is an acknowledged and important detail in the Robert Kirkman-penned comic book series that inspired the AMC hit.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="ToWW7Ri6D4Gi2h8ktkw6tN" name="al bundy married with children.jpg" alt="Al Bundy grimace face in Married with Children" src="https://cdn.mos.cms.futurecdn.net/ToWW7Ri6D4Gi2h8ktkw6tN.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Hulu)</span></figcaption></figure><h2 id="al-dreamt-peg-s-pregnancy-married-with-children">Al Dreamt Peg's Pregnancy (Married…. With Children)</h2><p>By the end of <em>Married… with Children</em>'s first season, half of which saw Peg (Katey Sagal) pregnant, it is revealed to have been all Al's (Ed O'Neill) dream but there is actually a dark truth to this retcon. As the actor explains in her memoir, <em>Grace Notes</em>, Sagal's real-life pregnancy at this time was written into the show but when she suffered a miscarriage, it was decided that the show would not bring another child into the cast.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="xQBmcBy3SfhYfLwxdqKZd8" name="spongebobsandy" alt="SpongeBob and Sandy meeting for the first time on SpongeBob Squarepants" src="https://cdn.mos.cms.futurecdn.net/xQBmcBy3SfhYfLwxdqKZd8.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Nickelodeon)</span></figcaption></figure><h2 id="spongebob-knew-sandy-as-a-child-spongebob-squarepants-kamp-koral-spongebob-s-under-years">SpongeBob Knew Sandy As A Child (SpongeBob SquarePants/Kamp Koral: SpongeBob's Under Years)</h2><p>In the second-ever episode of <em>SpongeBob Squarepants</em>, "Tea at the Treedome," we see the title character (voiced by Tom Kenny) meet Sandy Cheeks (Carolyn Lawrence) for the very first time. However, the prequel spin-off, <em>Kamp Koral: SpongeBob's Under Years</em>, suggests that the sea sponge and the squirrel knew each other when they stayed at the eponymous camp as children.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="nsc3ysMEqZNvyctb5pcRxU" name="kingofthehillpeggysmom" alt="Peggy confronting her mom in a barn on King of the Hill" src="https://cdn.mos.cms.futurecdn.net/nsc3ysMEqZNvyctb5pcRxU.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="peggy-s-mom-keeps-changing-king-of-the-hill">Peggy's Mom Keeps Changing (King Of The Hill)</h2><p>The first time <em>King of the Hill</em> introduces Peggy's mother, she is depicted as a suburban homemaker but is later reinvented almost completely as the wife of a bitter old rancher. That is not even counting the fact that, in an episode when Bobby's secret admirer turns out to be his grandmother playing a trick, the elderly woman in question is neither Hank's nor Peggy's mother.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="2BDUFBF25JF9dfdQpkN7P8" name="theofficeandydadguitar" alt="Stephen Collins and Ed Helms singing together on The Office" src="https://cdn.mos.cms.futurecdn.net/2BDUFBF25JF9dfdQpkN7P8.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="andy-s-father-s-name-changes-the-office">Andy's Father's Name Changes (The Office)</h2><p>In NBC's <em>The Office</em>, after proposing to Angela (Angela Kinsey), Andy (Ed Helms) refers to his mother and father as Andrew and Ellen Bernard, implying that he is Andy Bernard Jr. However, when we meet his parents in "The Garden Party," the father is identified as Walter Bernard Sr. (Stephen Collins) and Andy explains that he used to be named Walter Jr. before his younger brother (played by Josh Groban) was deemed more worthy of the moniker.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="XhjAa4uLEGpNEc5BQf6b7n" name="Screen Shot 2022-11-21 at 10.25.30 AM.jpg" alt="Amy Jo Johnson and Jason David Frank on Mighty Morphin Powers" src="https://cdn.mos.cms.futurecdn.net/XhjAa4uLEGpNEc5BQf6b7n.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Hasbro)</span></figcaption></figure><h2 id="the-rules-for-transferring-powers-mighty-morphin-power-rangers">The Rules For Transferring Powers (Mighty Morphin Power Rangers)</h2><p>In Season 2 of <em>Mighty Morphin Power Rangers</em>, when Jason (Austin St. John), Trini (Thuy Trang), and Zack (Walter Emanuel Jones) are forced to leave, the team needs to acquire a special sword to transfer their powers to Rocky (Steve Cardenas), Aisha (Karan Ashley), and Adam (Johnny Yong Bosch). However, in the following season, when Kimberly (Amy Jo Johnson) needed to give her powers to Kat (Catherine Sutherland), she just handed over her power coin.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ Candace Cameron Bure Watched Full House For The First Time In Ages: ‘Oh…I Understand Why The Show’s Not Been Off The Air In 35 Years’ ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/candace-cameron-bure-watched-full-house-understand-whyshows-not-off-air-35-years</link>
                                                                            <description>
                            <![CDATA[ It's a great show. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">HZn3TR9UEcKRvx9rMCjGji</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/czBMSfC8PYuHj36dTniHA-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Sat, 30 Nov 2024 00:35:25 +0000</pubDate>                                                                                                                                <updated>Thu, 05 Dec 2024 20:54:43 +0000</updated>
                                                                                                                                            <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Megan Behnke ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/FBUR6A5F9FTHQpVfjSuYpL.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Megan Behnke has been a Freelance TV News Writer at CinemaBlend since 2021. She has worked at multiple entertainment outlets, including as a Writer and Editor at Nerds and Beyond, TV and Movie News Writer at CBR, and a Freelance Writer at TV Fanatic, writing about topics she&#039;s passionate about like pop culture. She graduated from the University of Wisconsin Oshkosh with a degree in Multimedia Journalism in 2020, writing for the school’s newspaper during her time there. Her expertise in entertainment is mainly in television, but she has written about movies, music, and local events as well.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What They&#039;re Into&lt;/strong&gt;: Megan specializes in television writing, particularly procedurals. 9-1-1 and the Chicago Franchise are currently her favorites, where she can be found obsessively watching the latest episode or coming up with theories. She also loves to listen to music, with Taylor Swift being on the top of her playlist. She isn’t a huge sports person but will occasionally root for the Green Bay Packers, Milwaukee Brewers, and Wisconsin Badgers. As for movies, it’s hard to pick a favorite, but the Marvel Cinematic Universe reigns as her favorite franchise. She used to be a book nerd in grade school, with her favorite genre being fantasy or YA. Her favorite snack is sour cream and onion Pringles, while pizza is her all-time favorite food.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What They&#039;re Excited About Right Now&lt;/strong&gt;: Manifest Season 4 finally coming to Netflix, One Chicago, and Taylor Swift’s upcoming Midnights album, which will be on repeat.&lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/czBMSfC8PYuHj36dTniHA-1280-80.jpg">
                                                            <media:credit><![CDATA[Max]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Candace Cameron Bure as DJ Tanner on Full House.]]></media:description>                                                            <media:text><![CDATA[Candace Cameron Bure as DJ Tanner on Full House.]]></media:text>
                                <media:title type="plain"><![CDATA[Candace Cameron Bure as DJ Tanner on Full House.]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/czBMSfC8PYuHj36dTniHA-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <iframe src="https://content.jwplatform.com/players/io2BYjZB.html" id="io2BYjZB" title="Candace Cameron Bure Opens Up About Taking A Ten-year Break From Acting, And Why She Returned" width="600" height="338" frameborder="0" scrolling="auto" allowfullscreen></iframe><p>Thanks to streaming, fans old and new have been able to watch classics and new favorites, including <em>Full House</em>. The TGIF sitcom is one of the <a href="https://www.cinemablend.com/streaming-news/best-shows-streaming-on-max">best shows streaming on Max</a> and still remains popular to this day even almost 30 years after its finale. While watching the series for the first time in ages, Candace Cameron Bure came to a realization about <em>Full House</em>’s popularity.</p><p>The <a href="https://www.cinemablend.com/television/candace-cameron-bure-opens-up-about-hallmark-exit-and-what-she-loves-about-gaf">former Hallmark star</a> was a guest on Andrea Barber and Jodie Sweetin’s <em>Full House </em>rewatch podcast <a href="https://www.instagram.com/reel/DC2CgKQyS7_/"><em>How Rude, Tanneritos!</em></a>, co-hosting with Barber. The two were discussing and recapping Season 3, Episode 22, “Three Men and Another Baby,” which saw the Tanners babysitting a neighbor’s infant while Joey is stumped over D.J.’s math homework. Bure shared her excitement in co-hosting with Barber and shared what she realized while watching <em>Full House</em>:</p><div><blockquote><p>I haven’t watched Full House in so long, so many years. I’m watching the episode, I’m laughing out loud, and then I was like, ‘Oh, now I understand why the show’s never been off the air in 35 years.’ I’m like, ‘This is so sweet, it’s so cute, like all the things.’</p></blockquote></div><p>While <em>Full House </em>may not exactly be airing new episodes on ABC anymore, it is still a consistent fan-favorite on streaming and is one of the <a href="https://www.cinemablend.com/television/sitcoms-that-are-perfect-next-long-binge">sitcoms perfect for long-time viewing</a> with nine seasons. The series ran from 1987 to 1995 and has even found new fans, remaining so popular that the <em>Fuller House</em> sequel series lasted for five seasons for those with a <a href="https://www.cinemablend.com/streaming-news/netflix-subscription-the-plans-the-price-and-whats-included">Netflix subscription</a>. It’s sweet that Bure is now basically coming to terms with just how magical <em>Full House </em>was and still is and why it resonates with so many people. From a viewer’s standpoint, that is!</p><p>Candace Cameron Bure’s <em>Full House </em>rewatch comes months after she reacted to a <a href="https://www.cinemablend.com/television/full-house-candace-cameron-bure-reacts-news-story-adding-dj-tanner-clip">local news story adding ‘90s flair with a clip of D.J.</a> taking the SATs, proving that even an episode from the ‘90s can still very much have content relevant in today’s age. It's yet another reason why the show is still loved on top of the <a href="https://www.cinemablend.com/television/retro-tv-theme-songs-that-still-slap">retro theme song that still slaps</a>. Whether Bure has been watching the entire series or just the singular episode is unknown, but now I need her thoughts on the rest of the series.</p><p>Even though Bure doesn’t watch <em>Full House </em>very often, she still posts about the show from time to time. She previously <a href="https://www.cinemablend.com/television/candace-cameron-bure-celebrated-36-years-as-full-houses-dj-tanner">celebrated 36 years of being cast as D.J. Tanner</a> in 2023 and <a href="https://www.cinemablend.com/television/full-house-actor-classic-reaction-candace-cameron-bure-shared-throwback-photos-cant-get-enough">shared sweet throwback photos of her and on-screen beau Scott Weinger</a>. Additionally, she is still close to much of the cast despite her <a href="https://www.cinemablend.com/television/jodie-sweetin-candace-cameron-bure-feud-full-house-co-star-calls-out-not-liking-last-supper-olympics-opening-ceremony">falling out with Jodie Sweetin</a>. Aside from appearing on <em>How Rude, Tanneritos!</em>, she gave <a href="https://www.cinemablend.com/television/see-john-stamos-candace-cameron-bure-lovely-messages-full-house-co-star-dave-coulier-cancer-battle">well wishes to Dave Coulier after his cancer diagnosis</a> was made public, and frequently speaks highly of <a href="https://www.cinemablend.com/television/full-house-star-bob-saget-is-dead-at-65">the late Bob Saget</a>, who died in 2022, and expresses how much she misses her on-screen dad.</p><p>It wouldn’t be surprising if <em>Full House </em>continues to make people laugh for years to come. Even if it’s not one of the <a href="https://www.cinemablend.com/television/100-best-tv-sitcoms-of-all-time-ranked">best sitcoms of all time</a>, the show still comes pretty close. The comedy even got a revival even when it <a href="https://www.cinemablend.com/television/tv-shows-that-really-did-not-need-reboots">may not have needed a reboot</a>. Whether or not it will get <a href="https://www.cinemablend.com/television/jodie-sweetin-has-idea-full-house-cast-should-do-another-series-i-dont-hate-it">another series in the future with a <em>Golden Girls</em>-esque bent</a> is unknown, but for now, those with a <a href="https://www.cinemablend.com/television/2570432/subscribing-to-hbo-max-what-to-know-about-the-price-options-and-what-the-streaming-service-offers">Max subscription</a> can laugh and cry while watching <em>Full House</em>, just like Bure. </p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ 32 Sitcoms That Are Perfect For Your Next Long-Binge ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/sitcoms-that-are-perfect-next-long-binge</link>
                                                                            <description>
                            <![CDATA[ Get ready to laugh your pants off. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">kF7AcgzPiV4B2fPrfHBsde</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/syVjkBSAjtLriAG74dq5kR-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Mon, 25 Nov 2024 14:34:00 +0000</pubDate>                                                                                                                                <updated>Tue, 03 Dec 2024 14:11:38 +0000</updated>
                                                                                                                                            <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Alexandra Ramos ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/4vCq2c3J9ZiZUXQ3hPz69T.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Alexandra Ramos is a Content Producer at CinemaBlend. She first started off working in December 2020 as a Freelance Writer after graduating from the Pennsylvania State University with a degree in Journalism and a minor in English. She later moved over to full-time in July of 2021, and primarily works in features for movies, TV, and sometimes video games. She is also the main person who runs both our daily newsletter, The CinemaBlend Daily, and our ReelBlend newsletter that is sent out bi-weekly to patrons.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;
&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Into&lt;/strong&gt;: Alex is into many things. She loves all kinds of movies except for super sappy romantic ones - with the only redeeming case being The Notebook, and is a big fantasy nerd. She’s a huge fan of the streaming shows that have been released, and loves to watch series’ like The Witcher, Shadow &amp;amp; Bone, and more. Her all-time favorite TV show has to be a solid three-way tie between Breaking Bad, Game of Thrones and Attack on Titan - she just can’t seem to pick one. Alex is also a big Marvel nerd, and will defend Scarlet Witch until her dying day. For years, she’s been an avid gamer, primarily for the PlayStation, and has become a part of the fanbase for games like The Last Of Us, God of War, Spider-Man, and more, but that won’t stop her from playing simple games like Animal Crossing, or FPS’ like Call of Duty. Alex is also a big sports fan and considers herself a couchside coach because she will threaten to throw stuff at her TV if Penn State or the NY Giants are losing (which is often), usually with pizza in her hands.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Excited About Right Now&lt;/strong&gt;: The Boys Season 4 and its spinoff, Gen V Season 2, House of the Dragon Season 2, The Bear Season 4, Fallout, and Bridgerton Season 3 because I&#039;m missing my steamy romance.&amp;nbsp;&lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/syVjkBSAjtLriAG74dq5kR-1280-80.jpg">
                                                            <media:credit><![CDATA[Max]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Chandler Bing (Matthew Perry), Rachel Green (Jennifer Aniston) and Monica Gellar (Courteney Cox) all look up in anticipation on the Friends episode &quot;The One Where They Switch Apartments.&quot;]]></media:description>                                                            <media:text><![CDATA[Chandler Bing (Matthew Perry), Rachel Green (Jennifer Aniston) and Monica Gellar (Courteney Cox) all look up in anticipation on the Friends episode &quot;The One Where They Switch Apartments.&quot;]]></media:text>
                                <media:title type="plain"><![CDATA[Chandler Bing (Matthew Perry), Rachel Green (Jennifer Aniston) and Monica Gellar (Courteney Cox) all look up in anticipation on the Friends episode &quot;The One Where They Switch Apartments.&quot;]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/syVjkBSAjtLriAG74dq5kR-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>There are so many shows out there that are perfect for your next binge. They could be one of the <a href="https://www.cinemablend.com/television/2564797/the-best-shows-to-binge-watch-on-netflix-right-now"><u>best shows to watch on Netflix</u></a> or even be an original series for a streaming service – either way, they are full of life and hilarity. And if you're looking for a new show to watch, you might want to consider any of the following options for your next best sitcom. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="wT64qZSrdGeXYRXTbGdd6o" name="RachelChandlerFriends" alt="Jennifer Aniston as Rachel talking to Matthew Perry as Chandler on her apartment couch in Friends" src="https://cdn.mos.cms.futurecdn.net/wT64qZSrdGeXYRXTbGdd6o.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="friends-2">Friends</h2><p>I can't have a sitcom list and not write about <em>Friends. </em>The series was a huge hit for several years, running for ten seasons and making the <a href="https://www.cinemablend.com/television/2474356/what-have-the-friends-cast-been-up-to-since-the-show-ended"><u><em>Friends </em></u><u>cast</u></a> the vast stars they are today. The series follows a group of friends who live in New York City and follow their personal and professional lives. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="SrBUjcE8uJEghm4CWai8KF" name="hyimymtricycle.jpg" alt="Jason Segel, Neil Patrick Harris, and Josh Radnor on How I Met Your Mother" src="https://cdn.mos.cms.futurecdn.net/SrBUjcE8uJEghm4CWai8KF.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="how-i-met-your-mother">How I Met Your Mother</h2><p>For nine seasons, <em>How I Met Your Mother </em>dominated the world. The <a href="https://www.cinemablend.com/television/2474932/how-i-met-your-mother-whats-the-cast-up-to-now"><u><em>How I Met Your Mother </em></u><u>cast</u></a> was exceptionally popular, with skyrocketing careers, and featured some of the funniest jokes ever. If you ignore the finale (which most tend to do), it's honestly one of the best shows out there. The series follows the main character as he tells his children about how he met their mother.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="9HLZKgprWH2CJfXrouaN7b" name="feylisteningjenna.jpg" alt="Tina Fey spending time out on the town with Jane Krakowski on 30 Rock" src="https://cdn.mos.cms.futurecdn.net/9HLZKgprWH2CJfXrouaN7b.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="30-rock">30 Rock</h2><p>Created by Tina Fey, <em>30 Rock </em>ran for seven seasons and was a hilarious addition to the sitcom's run. The series follows the lives of workers at a fictional sketch show in New York City, based on Fey's time working on <em>Saturday Night Live. </em>The <a href="https://www.cinemablend.com/television/2571155/30-rock-cast-what-the-nbc-comedy-stars-are-doing-now-including-tina-fey"><u><em>30 Rock </em></u><u>cast</u></a> is hilarious in so many ways. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="HRiMD3u5mH2z3LiqjH2rnC" name="Fi-T-Top10-Its-Always-Sunny-In-Philadelphia-Moments-720p30.jpg" alt="The main cast of It's Always Sunny in Philadelphia." src="https://cdn.mos.cms.futurecdn.net/HRiMD3u5mH2z3LiqjH2rnC.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: FXX)</span></figcaption></figure><h2 id="it-s-always-sunny-in-philadelphia">It's Always Sunny In Philadelphia</h2><p>Okay, so this series is the definition of a <em>long </em>binge. <em>It's Always Sunny in Philadelphia </em>has run forever, it seems. It follows the story of a group of friends (and one annoying father) who live in Philadelphia and get up to the craziest things (usually illegal). I mean, this series is iconic—it can't really get better than this one. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="ieLwrvGmyL78CHDVZCSjvB" name="gregory and janine s4 premiere abbott" alt="Gregory holding his hand out and Janine standing next to him, also holding up her hand." src="https://cdn.mos.cms.futurecdn.net/ieLwrvGmyL78CHDVZCSjvB.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney/Gilles Mingasson  )</span></figcaption></figure><h2 id="abbott-elementary">Abbott Elementary</h2><p><em>Abbott Elementary </em>is on the fast track to becoming an all-time great show. The series follows the lives of teachers who work at a public school in Philadelphia and the struggles they have to go through to make their children happy and give them a good environment, as well as their own personal lives. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="HDXcrw4EC38A42jsi59iYc" name="MV5BNjczMjQ3N2EtYWYyZC00YjUxLWEwMDItODgxNzlmNTcwNWIzXkEyXkFqcGdeQXVyMDgyNjA5MA@@._V1_.jpeg" alt="Kelsey Grammer as Frasier Crane in Cheers" src="https://cdn.mos.cms.futurecdn.net/HDXcrw4EC38A42jsi59iYc.jpeg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Paramount)</span></figcaption></figure><h2 id="frasier-2">Frasier</h2><p>Running for eleven seasons, <em>Frasier </em>is a spinoff of <em>Cheers </em>and follows the psychiatrist Frasier Crane, who travels back home to Seattle and documents his personal and professional life. Talk about an incredible spinoff – and it <a href="https://www.cinemablend.com/streaming-news/longtime-frasier-fan-whether-viewers-need-watch-kelsey-grammer-original-paramount-revival"><u>earned a reboot several years later</u></a> on Paramount+. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="bN6R27SYoxwnHWwQAt2bCk" name="fx3v60q6qz7z." alt="Steve Carell as Michael Scott in The Office" src="https://cdn.mos.cms.futurecdn.net/bN6R27SYoxwnHWwQAt2bCk.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="the-office">The Office</h2><p>I mean, obviously, I have to include <em>The Office. </em>Running for eleven seasons, the series followed the lives of workers in a paper company in Scranton and is considered one of the best mockumentary sitcoms of all time. <a href="https://www.cinemablend.com/television/2493700/what-the-office-cast-is-doing-now"><u><em>The Office </em></u><u>cast</u></a> is super iconic, and after one watch, you'll be returning to this show like a security blanket. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="vWXAZ3vqySfLLGnezYcvwm" name="R.05fd470dcf3ab566463c03cf31947e58.jpeg" alt="Donald Glover smiling as Troy Barnes in Community" src="https://cdn.mos.cms.futurecdn.net/vWXAZ3vqySfLLGnezYcvwm.jpeg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Sony Pictures Television)</span></figcaption></figure><h2 id="community">Community</h2><p>With six seasons, <em>Community </em>is a fun one to watch. It follows five misfits who go to a community college and form a study group together – which gets them into hilarious situations. The series is hysterical, and while Season 5 is a little iffy (in my personal opinion and many others), it's still worth a binge – especially since <a href="https://www.cinemablend.com/streaming-news/community-movie-what-we-know-about-the-upcoming-peacock-sequel-film-to-the-series"><u>a </u><u><em>Community </em></u><u>movie</u></a> is in the works. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="2J7pBzmRx6TEd8GAiBAx67" name="cheers woody and sam.jpg" alt="Woody Harrelson waving while Ted Danson looks annoyed on Cheers" src="https://cdn.mos.cms.futurecdn.net/2J7pBzmRx6TEd8GAiBAx67.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="cheers">Cheers</h2><p>Running for eleven seasons, <em>Cheers </em>is one of the most iconic sitcoms of all time. The show mainly revolves around patrons and friends who gather at a bar as we follow their lives both in and out of the world. The series is responsible for creating several big stars, such as Ted Danson, Kirstie Alley, Kelsey Grammer, and Woody Harrelson. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="sdGT8t6VXzLKXrg7AiaiY9" name="unbreakable kimmy schmidt netflix.png" alt="ellie kemper in unbreakable kimmy schmidt" src="https://cdn.mos.cms.futurecdn.net/sdGT8t6VXzLKXrg7AiaiY9.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="unbreakable-kimmy-schmidt">Unbreakable Kimmy Schmidt</h2><p>While it only ran for four seasons, I personally love <em>Unbreakable Kimmy Schmidt. </em>The series follows a young woman who was locked away in a bunker for several years only to emerge and find herself a stranger in this new modern world. With the help of some unlikely friends, she finds her path. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="ZcLdRUMMaoaY3XG5BtL2DB" name="charlie sheen two and a half men.jpeg" alt="Charlie Sheen on Two and a Half Men" src="https://cdn.mos.cms.futurecdn.net/ZcLdRUMMaoaY3XG5BtL2DB.jpeg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros. Television)</span></figcaption></figure><h2 id="two-and-a-half-men">Two And A Half Men</h2><p>As someone <a href="https://www.cinemablend.com/television/i-binge-watched-all-of-two-and-a-half-men-and-it-was-something"><u>who watched </u><u><em>Two and a Half Men</em></u></a> for the first time a few years ago, I find this series hilarious. Running for twelve seasons and originally starring Charlie Sheen (before switching over to Ashton Kutcher years later), the series follows a man who houses his brother and his son during a divorce and the craziness they get into as time goes on. This series is <em>wild, </em>so be prepared for some jokes that most likely did not age well but are still fun. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="N6p5wMQfFm5BZtnrJfZoqg" name="S07E1213.jpg" alt="Amy Poehler in Parks and Recreation" src="https://cdn.mos.cms.futurecdn.net/N6p5wMQfFm5BZtnrJfZoqg.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="parks-and-recreation">Parks And Recreation</h2><p><em>Parks and Recreation </em>aired a few years after <em>The Office </em>ended, and people loved this show just as much. The series mainly follows Leslie Knope, who works at the Parks Department in a fictional town and cares deeply about her job, causing headaches for others. If you take a look at the<a href="https://www.cinemablend.com/television/2495456/what-the-parks-and-recreation-cast-members-are-doing-now"><u> </u><u><em>Parks and Recreation </em></u><u>cast</u></a>, you'll see a ton of familiar faces. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="buufjMTgjx7rNo8xEMD6aZ" name="IMG_2436.JPG" alt="Season 7 opener to That '70s Show" src="https://cdn.mos.cms.futurecdn.net/buufjMTgjx7rNo8xEMD6aZ.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Peacock)</span></figcaption></figure><h2 id="that-70s-show">That '70s Show</h2><p>Running for eight seasons, <em>That '70s Show </em>was a series that raised me as a kid. The series follows a group of teenagers who are living in the 1970s and their experiences with the culture there. The series was so popular that it spawned a spinoff years later called <a href="https://www.cinemablend.com/streaming-news/after-netflix-axed-that-90s-show-canceled-unstable"><u><em>That '90s Show, </em></u><u>although it was short-lived</u></a>. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="js8VGDatWTM5zwgJuoayoE" name="seinfeld-george-henry-viii" alt="George with Kramer as Henry VIII in Seinfeld" src="https://cdn.mos.cms.futurecdn.net/js8VGDatWTM5zwgJuoayoE.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="seinfeld-2">Seinfeld</h2><p>I mean, <em>obviously, </em>I have to put <em>Seinfeld </em>on here. Created by comedy legends Jerry Seinfeld and Larry David, <em>Seinfeld </em>is "a show about nothing," following the lives of a fictionalized version of Seinfeld and his friends in New York City during the 1980s and 90s. The series ran for nine seasons and created the famous <a href="https://www.cinemablend.com/television/1703049/seinfeld-the-cast-then-and-now"><u><em>Seinfeld </em></u><u>cast</u></a>. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="8H8A79hd2xLAsE9yWkDy4J" name="willsmithfreshprinceofbelairfourthwall.jpg" alt="Will Smith on The Fresh Prince of Bel-Air" src="https://cdn.mos.cms.futurecdn.net/8H8A79hd2xLAsE9yWkDy4J.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="the-fresh-prince-of-bel-air-2">The Fresh Prince Of Bel-Air</h2><p>Where was he raised? In West Philadelphia, of course. <em>The Fresh Prince of Bel-Air </em>starred Will Smith and followed the story of a young man who is sent to his uncle in Bel-Air after getting into trouble back home in Philly. His mother hopes that his uncle can straighten him out, and it just turns into hilarity for this fresh prince. The series ran for six seasons. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="ic6EtHkLPs22ZsB52VQzRX" name="Untitled design - 2022-03-24T105110.047.png" alt="Andy Sanberg as Jake Peralta in Brooklyn 99" src="https://cdn.mos.cms.futurecdn.net/ic6EtHkLPs22ZsB52VQzRX.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="brooklyn-nine-nine">Brooklyn Nine-Nine</h2><p>The <a href="https://www.cinemablend.com/television/brooklyn-nine-nine-what-the-cast-of-the-iconic-comedy-is-doing-next"><u><em>Brooklyn Nine-Nine </em></u><u>cast</u></a> is hilarious in every way possible, and I thoroughly recommend this series with my whole heart. The series follows the lives of workers at a fictional police station in New York City, from their professional lives to their own, and how they all intertwine. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="cH4dFPDPdMSpb3b43ktXL7" name="bobhope.jpg" alt="Betty White in The Golden Girls" src="https://cdn.mos.cms.futurecdn.net/cH4dFPDPdMSpb3b43ktXL7.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="the-golden-girls-2">The Golden Girls</h2><p>I <em>have </em>to recommend <em>The Golden Girls. </em>Running for seven seasons and just as iconic as you would expect, <em>the show </em>starred Bea Arthur, Betty White, Rue McClanahan, and Estelle Getty as four older women who lived together in their later years in Miami and the crazy lives they got into. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="y5nRHcSHEh4QgwyP7RR4E3" name="Bob's Burgers the Belcher family crowds around a computer.jpg" alt="The Belcher family crowds around a computer in Bob's Burgers." src="https://cdn.mos.cms.futurecdn.net/y5nRHcSHEh4QgwyP7RR4E3.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="bob-s-burgers">Bob's Burgers</h2><p>Animated shows are probably some of the best series to binge because they often have <em>so </em>many seasons, and <em>Bob's Burgers </em>is an excellent example of that. The series, which has been running for fifteen seasons and counting, follows the lives of a family who own a burger shop and what they get up to when they're not in the kitchen—as well as the drama that unfolds in their restaurant. It's hilarious, and I highly recommend it. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="zTgbwdaoR9kdsGFogNJcKV" name="Screenshot (268).jpg" alt="Ricky and Lucy in I Love Lucy." src="https://cdn.mos.cms.futurecdn.net/zTgbwdaoR9kdsGFogNJcKV.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="i-love-lucy">I Love Lucy</h2><p>Of<em> course, </em>I have to put the <em>original </em>sitcom here. <em>I Love Lucy </em>is a classic sitcom starring Lucille Ball and Desi Arnaz as Lucy and Ricky, a couple living in New York City, and the shenanigans that Lucy gets into all the time. I'm often not the best person to recommend older TV shows because most tend to miss the mark, but <em>this </em>is one of the best you can watch. The series ran for six seasons. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="6eiP9MxRFdWYcME5euHuSf" name="JulieBowenModernFamily.jpg" alt="Julie Bowen talking into the camera on Modern Family" src="https://cdn.mos.cms.futurecdn.net/6eiP9MxRFdWYcME5euHuSf.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="modern-family-2">Modern Family</h2><p><em>Modern Family </em>is an absolute icon, and yes, you need to watch it. Running for eleven seasons, <em>It </em>is exactly what you would expect it to be—it follows the lives of a modern-age family and the craziness they get into. The <a href="https://www.cinemablend.com/television/2495333/what-the-modern-family-cast-is-doing-next"><u><em>Modern Family </em></u><u>cast</u></a> is hysterical, and I can assure you that you will laugh several times throughout the show. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="tYCG5vcw2v3d4HCPptJhWj" name="The Nanny.jpg" alt="Fran Fine applying to be the Sheffields' nanny in The Nanny pilot." src="https://cdn.mos.cms.futurecdn.net/tYCG5vcw2v3d4HCPptJhWj.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="the-nanny-2">The Nanny</h2><p>"She's the nanny, the nanny named Fran!" I can assure you that the theme song for this show will be stuck in your head by the end of this binge. Running for six seasons, <em>The Nanny, </em>starring Fran Drescher, follows the lives of a fashionista who decides to take on the role of a nanny for three children when she needs the money, only for her life to intertwine with their father, Peter Marc Jacobson. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="2TWEgk8jugHrnegUePmTKj" name="Curb Your Enthusiasm Series Finale-id_f70e5b12-b668-4186-95f1-90d10f6c046a.jpeg" alt="in Curb Your Enthusiasm series finale" src="https://cdn.mos.cms.futurecdn.net/2TWEgk8jugHrnegUePmTKj.jpeg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO)</span></figcaption></figure><h2 id="curb-your-enthusiasm">Curb Your Enthusiasm</h2><p>Created by Larry David and running for twelve seasons (despite that twenty-four-year-long streak), <em>Curb Your Enthusiasm </em>is a hilarious HBO series that stars David as a fictionalized version of himself as he lives in Los Angeles and his days as a retired TV producer and writer, and the stuff he gets into as he deals with all the drama Hollywood can bring. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="wrL4qJmaFXyVD4wGn7sAYK" name="Joey-Jesse-Danny-Full-House.jpg" alt="Dave Coulier and Bob Saget on Full House" src="https://cdn.mos.cms.futurecdn.net/wrL4qJmaFXyVD4wGn7sAYK.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="full-house-3">Full House</h2><p>The <em>Full House </em>cast is iconic because of how great this series was and how many of us were raised on it, honestly. <em>Full House </em>follows the lives of three men, one a widow, one a brother-in-law, and the other a best friend, who all live in the same house, and work together to raise the children of one after his wife passes away. The series ran for eight seasons. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:57.03%;"><img id="XzjuY3o7TJebB4t98suLtX" name="home sleeping the simpsons" alt="Screenshot of Homer sleeping in his chair at the power plant in The Simpsons" src="https://cdn.mos.cms.futurecdn.net/XzjuY3o7TJebB4t98suLtX.jpg" mos="" align="middle" fullscreen="" width="1280" height="730" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney+)</span></figcaption></figure><h2 id="the-simpsons-2">The Simpsons</h2><p>Obviously, I have to put <em>The Simpsons </em>on this list. <em>The Simpsons </em>is probably one of the most iconic TV families ever, following the animated tales of Homer and his family as they get into the craziest shenanigans you could ever think of and more. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="LARG947x8E3eKx2Lq3itU7" name="jimparsonskaleycuocothebigbangtheory" alt="Sheldon Cooper (Jim Parsons) and Penny (Kaley Cuoco) share a car ride on The Big Bang Theory" src="https://cdn.mos.cms.futurecdn.net/LARG947x8E3eKx2Lq3itU7.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="the-big-bang-theory">The Big Bang Theory</h2><p>Running for twelve seasons, <em>The Big Bang Theory </em>was an extremely successful modern-day sitcom that followed several people living in California. It mainly followed the lives of Leonard and Sheldon, who they ran into as total science nerds, and the friends they surround themselves with. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="5y32gcugf934pYqdiWjQgU" name="China Problem.jpg" alt="Cartman and Butters in South Park." src="https://cdn.mos.cms.futurecdn.net/5y32gcugf934pYqdiWjQgU.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Comedy Central)</span></figcaption></figure><h2 id="south-park">South Park</h2><p><a href="https://www.cinemablend.com/television/most-outrageous-south-park-episodes"><u><em>South Park </em></u><u>has some outrageous episodes</u></a>, but this is the perfect binge if you want something that's way more adult. The series follows the lives of four fourth-graders in the world of South Park, a fictional town in Colorado, where literally <em>nothing </em>is off the table for the drama they get into. This series is just a lot to handle but so freaking hysterical. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="PKJ27wLtRafYB7MsazTPWV" name="scrubszachbraffsarahchalke.jpg" alt="Zach Braff and Sarah Chalke in Scrubs." src="https://cdn.mos.cms.futurecdn.net/PKJ27wLtRafYB7MsazTPWV.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Hulu)</span></figcaption></figure><h2 id="scrubs">Scrubs</h2><p>Created by Bill Lawrence (<em>Ted Lasso, Shrinking) </em>and running for nine seasons, <em>Scrubs </em>is the medical sitcom that you're in need of. The series follows the lives of workers at a hospital, following the medical interns as they work their way up in the world and the hilarious things that happen to them. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="77Za6uvTmBKptETZ876niA" name="Dan Levy in Schitt's Creek.png" alt="Dan Levy in Schitt's Creek" src="https://cdn.mos.cms.futurecdn.net/77Za6uvTmBKptETZ876niA.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="schitt-s-creek">Schitt's Creek</h2><p>While <em>Schitt's Creek </em>only ran for four seasons, its impact on pop culture is widely known. The series follows the lives of the Rose family, who suddenly lose everything in their name except for a little town the father bought as a joke years ago – Schitt's Creek, the place where they will begin their return to wealth. The <a href="https://www.cinemablend.com/television/2569420/schitts-creek-what-to-watch-if-youre-missing-the-cast-of-the-hilarious-comedy"><u><em>Schitt's Creek </em></u><u>cast</u></a> is absolutely hysterical. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="yfvWG8bWfiuqSZTiNEktnJ" name="selina veep.jpg" alt="Julia Louis-Dreyfus in the middle of an extremely frustrated moment in Veep." src="https://cdn.mos.cms.futurecdn.net/yfvWG8bWfiuqSZTiNEktnJ.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO)</span></figcaption></figure><h2 id="veep">Veep</h2><p>Starring Julia Louis-Dreyfus and running for seven seasons, <em>Veep </em>is a hilarious HBO sitcom and political satire show that will make you laugh for hours on end. The series follows the life of political figure Selina Meyer, who is the Vice President of the United States, and how she deals with what is thrown at her, as well as working with the president who drives her nuts. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="ipot9uoivTAHuzkHSCWvxi" name="rickandmortycouch.jpg" alt="Rick and Morty on the couch" src="https://cdn.mos.cms.futurecdn.net/ipot9uoivTAHuzkHSCWvxi.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Adult Swim)</span></figcaption></figure><h2 id="rick-and-morty">Rick And Morty</h2><p>Created by Dan Harmon, <em>Rick and Morty </em>is one of those animated sitcoms where you never know what is going to happen next, but you know it'll be hilarious. <em>Rick and Morty </em>follows the scientific adventures of Grandpa Rick and his grandson, Morty, as he takes him across multiple dimensions and into situations that really no young boy should ever experience. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="n7yzokCEUA8724tgYy2MTZ" name="GOB banner.jpg" alt="The cast of Arrested Development on Season 3 Episode 3." src="https://cdn.mos.cms.futurecdn.net/n7yzokCEUA8724tgYy2MTZ.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="arrested-development-3">Arrested Development</h2><p>Running for five seasons, with two of them happening in the later years of the 2010s, <em>Arrested Development </em>is the type of show that will make you laugh for hours. The series follows a formerly wealthy family as they try to adjust to normal everyday life – and they most certainly have a <em>hard </em>time doing it. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="j86WRvotzpXZWFNn9k5o3P" name="3DFTnMtiykYZGvbDQ9NfMo-1200-80 (1).jpg" alt="Tyler James Williams in Everybody Hates Chris." src="https://cdn.mos.cms.futurecdn.net/j86WRvotzpXZWFNn9k5o3P.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: UPN/The CW)</span></figcaption></figure><h2 id="everybody-hates-chris">Everybody Hates Chris</h2><p>Created by Chris Rock, <em>Everybody Hates Chris </em>stars Tyler James Williams and is loosely based on Rock's life when he was a teenager and what it was like living in New York City back in the 1980s as a teenager. It ran for four seasons (but to me, it should have ran for way more). </p><p>Any of these shows would be excellent picks for you to watch next. Now, I feel like I need to have a TV marathon. It's time to dim the lights and get the popcorn once again. </p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ People Complained After John Stamos Wore A Bald Cap In Support Of His Full House Co-Star, And Dave Coulier Had A Swift Response ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/people-complained-john-stamos-wore-bald-cap-in-support-of-full-house-co-star-and-dave-coulier-response</link>
                                                                            <description>
                            <![CDATA[ Dave Coulier announced his cancer diagnosis this month. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">NnVVSFQbZjaLYbLo9tRKAV</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/7pY2mo3fkcChCn5abpj27Y-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Tue, 19 Nov 2024 21:11:01 +0000</pubDate>                                                                                                                                <updated>Sat, 23 Nov 2024 16:06:20 +0000</updated>
                                                                                                                                            <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Erik Swann ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/rXkznL7DwWNoGfjx998J3Q.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Erik Swann is a Senior Content Producer at CinemaBlend. He began working with the publication in 2020 when he was hired as Weekend Editor. Today, he continues to write, edit and handle social media responsibilities over the weekend. On weekdays, he also writes TV and movie-related news and helps out with editing and social media as needed. He graduated from the University of Maryland, where he received a degree in Broadcast Journalism. After shifting into multi-platform journalism, he started working as a freelance writer and editor before joining CB. During his time with the site, he&#039;s been able to cover some excellent TV shows and films and interview some wonderful stars.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Into&lt;/strong&gt;: Erik is a superhero fan, and his love for comic books began after he first watched Batman: The Animated Series as a child. He also enjoys comedies, action/adventure flicks, dramas and science fiction. He has a love for sports as well, particularly professional basketball. Though he&#039;s a Maryland/Washington D.C. native, he roots for the Boston Celtics. Some of his all-time favorite TV shows are BTAS, Breaking Bad, Sanford and Son, Agents of S.H.I.E.L.D., Better Call Saul and Atlanta. And when it comes to movies, Beverly Hills Cop, A Raisin in the Sun, Toy Story, Iron Man, Star Wars, and Wall Street are among his favorites. He also enjoys a good pizza (preferably with pepperoni and mushrooms) while he&#039;s watching entertaining films and TV series.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Excited About Right Now&lt;/strong&gt;: Teenage Mutant Ninja Turtles: Mutant Mayhem, Reservation Dogs Season 3, Ahsoka, Loki Season 2, Invincible Season 2, Next Goal Wins and Chicken Run: Dawn of the Nugget.&lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/7pY2mo3fkcChCn5abpj27Y-1280-80.jpg">
                                                            <media:credit><![CDATA[HBO Max]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Joey and Jesse just changed Michelle in Full House]]></media:description>                                                            <media:text><![CDATA[Joey and Jesse just changed Michelle in Full House]]></media:text>
                                <media:title type="plain"><![CDATA[Joey and Jesse just changed Michelle in Full House]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/7pY2mo3fkcChCn5abpj27Y-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>Dave Coulier – the actor best known for playing Joey Gladstone on <em>Full House</em> and its sequel series, <em>Fuller House</em> – recently disclosed that he’s been diagnosed with cancer. The fan-favorite actor is currently battling Stage 3 non-Hodgkins lymphoma and, since he shared that information, he’s received <a href="https://www.cinemablend.com/television/see-john-stamos-candace-cameron-bure-lovely-messages-full-house-co-star-dave-coulier-cancer-battle"><u>support from John Stamos and Candace Cameron Bure</u></a> as well as other stars and various fans. Aiming to stand in solidarity with his friend, Stamos recently sported a bald cap, and that was met with backlash. With that, Coulier provided a swift response. </p><p>John Stamos took to Instagram this week to pay tribute to his longtime co-star amid his cancer battle. Famous for playing Jesse Katsopolis on one of the <a href="https://www.cinemablend.com/television/10-Greatest-TGIF-Comedies-All-Time-Ranked-120697.html"><u>best TGIF shows</u></a> and its spinoff and sporting sweet, black locks, Stamos sported a bald cap in several images he shared. In addition to sharing the pics, the <em>Grandfathered</em> alum also praised his good buddy for “handling this with so much strength and positivity.” You can check out the post down below: </p><div class="instagram-embed"><blockquote class="instagram-media"  data-instgrm-version="6" style="width:99.375%; width:-webkit-calc(100% - 2px); width:calc(100% - 2px);"><p><a href="https://www.instagram.com/p/DCiHQc0x6oc/" target="_blank">A post shared by John Stamos (@johnstamos)</a></p><p>A photo posted by  on </p></blockquote></div><p>Some fans expressed positive feelings over the <em>Big Shot</em> star's  gesture. Yet there were others who took issue with it. Some appeared to question why the actor didn’t actually shave his head, while others accused him of being performative with his actions. Dave Coulier himself seemingly caught wind of the responses and ultimately penned a response that was shared to <a href="https://www.instagram.com/p/DCj1m-qxPtN/?hl=en&img_index=1"><u>Instagram</u></a>. He began his statement by saying that he was “sorry to see a bunch of negative comments” at the start of his cancer journey. Coulier added: </p><div><blockquote><p>It’s our friendship (me and John) and this is how we are handling a very tough time. I’m a comedian and humor is what drives me. John knows how to cheer me up and I laughed out loud when he arrived wearing a bald cap — being a true loving friend and brother.</p></blockquote></div><p>The veteran comedian then went on to say that he’s heard from a number of people who’ve been encouraged by how he’s sought to spread awareness about cancer screenings. From there, he declared his intention to “laugh in the face of adversity” as he continues to deal with his medical situation. The <em>Muppet Babies</em> alum also shared another reason why his diagnosis is so personal for him:</p><div><blockquote><p>When I lost my sister, Sharon, my mother, Arlen, and my niece, Shannon to cancer, we tried to stay positive, and we made each other laugh through the worst of it. I’m choosing to spread the word about early cancer detection to help people. That’s just who I am. I wish nothing but love for all of you.</p></blockquote></div><div  class="fancy-box"><div class="fancy_box-title">More on Dave Coulier</div><div class="fancy_box_body"><figure class="van-image-figure "  ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Qu9zdCcg5PLjwiLji3G4Ao" name="fuller house danny joey.jpg" caption="" alt="Danny and Joey sitting at kitchen table in Fuller House series finale" src="https://cdn.mos.cms.futurecdn.net/Qu9zdCcg5PLjwiLji3G4Ao.jpg" mos="" link="" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pinterest-pin-exclude"></p></div></div><figcaption itemprop="caption description" class=""><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><p class="fancy-box__body-text"><a data-analytics-id="inline-link" href="https://www.cinemablend.com/television/full-house-dave-coulier-how-cast-preserves-bob-saget-memory">‘You Can Either Look At It As An Empty Well Or You Can Keep Filling That Well’: Full House’s Dave Coulier On How The Cast Preserves Bob Saget’s Memory</a></p></div></div><p>The <em>Full House</em> cast has shown over the years that they’re quite close. In many ways, they themselves have become a family in real life and have developed a bond similar to those of the characters they played. All have met up at conventions over the years, where they’ve regaled fans with behind-the-scenes stories from their hit shows. And, just a few years ago, they all came together to collectively mourn and pay tribute after the <a href="https://www.cinemablend.com/television/full-house-star-bob-saget-is-dead-at-65"><u>death of Bob Saget</u></a>. </p><p>Regardless of how some people may feel about John Stamos’ way of honoring his friend, it seems that he and Dave Coulier are remaining close at this time. We here at CinemaBlend wish Coulier the best as he continues to undergo treatment for cancer. Fans can also stream <em>Full House</em> using a <a href="https://www.cinemablend.com/television/2570432/subscribing-to-hbo-max-what-to-know-about-the-price-options-and-what-the-streaming-service-offers"><u>Max subscription</u></a>, while <em>Fuller House</em> can be accessed using a <a href="https://www.cinemablend.com/streaming-news/netflix-subscription-the-plans-the-price-and-whats-included"><u>Netflix subscription</u></a>.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ 32 TV Shows That Really Did Not Need Reboots ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/tv-shows-that-really-did-not-need-reboots</link>
                                                                            <description>
                            <![CDATA[ Would these technically count as reruns? ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">XSPrb7tBoDjTEmWdR7RiBM</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/cmNw8nVbWs4wr79gsPcfSJ-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Sat, 16 Nov 2024 14:32:00 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Jason Wiese ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/62SRu9Bi2SyJGrpzKXAfsK.jpg ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Jason Wiese writes feature stories for CinemaBlend. His occupation results from years dreaming of a filmmaking career, settling on a &quot;professional film fan&quot; career, studying journalism at Lindenwood University in St. Charles, MO (where he served as Culture Editor for its student-run print and online publications), and a brief stint of reviewing movies for fun. He would later continue that side-hustle of film criticism on TikTok (@wiesewisdom), where he posts videos on a semi-weekly basis.&lt;/p&gt;&lt;p&gt;&lt;br&gt;&lt;/p&gt;&lt;p&gt;Jason has been writing since he was able to pick up a washable marker, with which he wrote his debut illustrated children&#039;s story, later transitioning to a short-lived comic book series and (very) amateur filmmaking before finally settling on pursuing a career in writing about movies in lieu of making them. Look for his name in almost any article about Batman.&lt;/p&gt;&lt;p&gt;&lt;br&gt;&lt;/p&gt;&lt;p&gt;&lt;strong&gt;What He&#039;s Into&lt;/strong&gt;: Readers may notice a recurring theme of horror and superhero-related content (especially in regards to Batman) in much of Jason&#039;s work, but his favorite film of all time is more in line with traditional action/adventure stories: &lt;em&gt;Raiders of the Lost Ark&lt;/em&gt;. His favorite TV series is the gritty, grounded crime thriller &lt;em&gt;Breaking Bad&lt;/em&gt; and if you catching him reading anything, it is probably a comic book (and, more often than not, one featuring Batman). More important to him than entertainment, however, are his wife and two dogs.&lt;/p&gt;&lt;p&gt;&lt;br&gt;&lt;/p&gt;&lt;p&gt;&lt;strong&gt;What He&#039;s Excited About Right Now&lt;/strong&gt;: Jason typically tries to keep his excitement and expectations for any upcoming movies as low as possible, but he is certainly looking forward to returning to Matt Reeves&#039; vision of Gotham City in the upcoming follow-up to &lt;em&gt;The Batman&lt;/em&gt; and just about any horror movie set to haunt cinemas soon.&lt;/p&gt; ]]></dc:description>
                                                                                                                                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/cmNw8nVbWs4wr79gsPcfSJ-1280-80.jpg">
                                                            <media:credit><![CDATA[ABC]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Roseanne in the living room on Roseanne Season 10]]></media:description>                                                            <media:text><![CDATA[Roseanne in the living room on Roseanne Season 10]]></media:text>
                                <media:title type="plain"><![CDATA[Roseanne in the living room on Roseanne Season 10]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/cmNw8nVbWs4wr79gsPcfSJ-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>For every <a href="https://www.cinemablend.com/movies/movies-that-really-didn-t-need-reboots">unnecessary reboot of a beloved movie</a>, there seem to be just as many unnecessary reboots of a beloved TV series. While some would prove to be a welcome improvement on what came before, there are even more (including some successful ones) that we still feel we could have done without, given our continued enjoyment of what came before. We had almost too many examples to choose from while compiling this of TV shows that did not need to be rebooted.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Ub3HqGgwYgFmtL39QZgDyT" name="Knight Rider theme.jpg" alt="opening scene to Knight Rider" src="https://cdn.mos.cms.futurecdn.net/Ub3HqGgwYgFmtL39QZgDyT.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="knight-rider-1982-1986">Knight Rider (1982-1986)</h2><p>Despite its cheesy moments, <em>Knight Rider</em> was one of the <a href="https://www.cinemablend.com/television/great-sci-fi-tv-shows-from-the-70s-and-80s">best '80s sci-fi TV shows</a>, boasting one of David Hasselhoff's best performances in the role of Michael Knight – a government agent whose partner in fighting crime is an indestructible car powered by a sentient artificial intelligence called KITT (voice by William Daniels). In 2008, NBC aired a soft reboot, set in the same world but following a new protagonist (Justin Bruening as Mick Traceur) and a new KITT (voiced by Val Kilmer), which lacked the charisma, the fun, and much semblance of a brain, leading to its premature cancellation.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="8uUep59ChXYZTY7jDAbPm8" name="Screen Shot 2022-01-19 at 2.59.08 PM(1).jpg" alt="The Charmed cast" src="https://cdn.mos.cms.futurecdn.net/8uUep59ChXYZTY7jDAbPm8.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: The WB)</span></figcaption></figure><h2 id="charmed-1998-2006">Charmed (1998-2006)</h2><p>One of the <a href="https://www.cinemablend.com/movies/the-best-shannen-doherty-movies-and-tv-shows">best Shannen Doherty TV shows</a> was <em>Charmed</em>, which starred her, Holly Marie Combs, and Alyssa Milano as three sisters who discover they are descended from witches. After The WB became The CW, despite no real demand, the network developed a reimagining starring Melonie Diaz, Madeleine Mantock, and Sarah Jeffery that managed to last four seasons, despite criticism for its one-dimensional characters and uninspired plotlines.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="oY3yucafuN3GWGaTwwovXj" name="The Twilight Zone Eye of the Beholder.jpg" alt="Donna Douglas restrained in fright by William D. Gordon in The Twilight Zone." src="https://cdn.mos.cms.futurecdn.net/oY3yucafuN3GWGaTwwovXj.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="the-twilight-zone-1959-1964">The Twilight Zone (1959-1964)</h2><p>Creator and narrator Rod Serling's landmark <a href="https://www.cinemablend.com/television/great-horror-anthology-tv-shows-and-how-to-watch-them">horror anthology TV show</a>, <em>The Twilight Zone</em> has been resurrected numerous times. However, neither the late '80s revival, nor the early 2000s version with Forest Whitaker, or even producer and narrator Jordan Peele's iteration achieved the same acclaim as as the chilling and thought-provoking classic.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="N7exeZ3iQBSPka4V8mPomB" name="Screen Shot 2022-09-23 at 10.40.21 AM.jpg" alt="full house pilot final scene" src="https://cdn.mos.cms.futurecdn.net/N7exeZ3iQBSPka4V8mPomB.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC/HBO Max)</span></figcaption></figure><h2 id="full-house-1987-1995-2">Full House (1987-1995)</h2><p>What made <a href="https://www.cinemablend.com/television/john-stamos-explained-full-house-worked-despite-critics-hating-it"><em>Full House</em> successful despite its unimpressive critical reputation</a> was a healthy dose of wholesomeness amidst its generic family comedy antics. Netflix's revival, <em>Fuller House</em> – which recycled the plot but made DJ (Candace Cameron Bure), Stephanie (Jodie Sweetin), and Kimmy (Andrea Barber) the leads – had a decent five-season run, despite being criticized for the same things, in addition to relying mostly on nostalgia.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="MTofrf8eHfKa9eQRzkpD5G" name="bionic woman.jpg" alt="Lindsay Wagner on The Bionic Woman" src="https://cdn.mos.cms.futurecdn.net/MTofrf8eHfKa9eQRzkpD5G.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="the-bionic-woman-1976-1978">The Bionic Woman (1976-1978)</h2><p>Even with <em>Battlestar Galactica</em> producer David Eick involved, NBC's 2007 reboot of <em>The Bionic Woman</em> did not manage to be better, faster, or stronger, especially in the ratings. One would hope its cancellation after eight episodes teaches executives to avoid rebooting the series that star Lindsey Wagner's original sci-fi series was spun-off from <em>The Six Million Dollar Man</em>.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="iVSJfkbJwaxLiBTWVt5F3D" name="snooki.jpg" alt="Snooki talks to the camera on Jersey Shore Season 1" src="https://cdn.mos.cms.futurecdn.net/iVSJfkbJwaxLiBTWVt5F3D.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: MTV)</span></figcaption></figure><h2 id="jersey-shore-2009-2012">Jersey Shore (2009-2012)</h2><p>For a while, it seemed like the entire world was talking about the cast of <em>Jersey Shore</em>, even if most of the discussions surrounding their boisterous behavior and debaucherous shenanigans were mocking and disdainful. Years after it seemed like the world had finally forgotten about this uproarious reality show, MTV debuted <em>Jersey Shore Family Vacation</em> in 2018.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="t3yLfUbcoBrLFdPUKTwFkV" name="That-70s-Show-Cast-Everett-TCDTHSE_FE037-H-2022.jpg" alt="That '70s Show" src="https://cdn.mos.cms.futurecdn.net/t3yLfUbcoBrLFdPUKTwFkV.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: FOX)</span></figcaption></figure><h2 id="that-70s-show-1998-2006">That '70s Show (1998-2006)</h2><p>A <em>That '70s Show</em> spin-off was first attempted in 2002 with <em>That '80s Show</em>, which had little to no connection to the original, potentially costing it a longer life and better reception. At least Netflix's  <em>That '90s Show</em> – which sees Red (Kurtwood Smith) and Kitty's (Debra Jo Rupp) home overrun with a new batch of teens, including their granddaughter – can say it earned a decent following but not enough to last more than two seasons.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="6pr9qdu9vHDwt3SVoCaan5" name="Screenshot (2634).png" alt="The cast of Gossip Girl." src="https://cdn.mos.cms.futurecdn.net/6pr9qdu9vHDwt3SVoCaan5.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: The CW)</span></figcaption></figure><h2 id="gossip-girl-2007-2012">Gossip Girl (2007-2012)</h2><p>If there was any reason to bring back <em>Gossip Girl</em>, it might have been to correct the widely disappointing series finale reveal that Dan Humphrey (Penn Badgley) was the eponymous blogger the entire time. Instead, Max's short-lived retread of the hit CW drama, running between 2021 and 2023, introduced a whole new cast and attempted to freshen up the material with the overcooked theme of teens' relationship with social media.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="SPpBkj95gkBzKcccQAUD25" name="beverly hills 90210.png" alt="jenny garth and shannen doherty in beverly hills, 90210" src="https://cdn.mos.cms.futurecdn.net/SPpBkj95gkBzKcccQAUD25.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="beverly-hills-90210-1990-2000">Beverly Hills, 90210 (1990-2000)</h2><p>The CW's <em>90210</em> was developed as a continuation of producer Aaron Spelling's primetime soap opera and even featured a few returning <a href="https://www.cinemablend.com/television/2568138/beverly-hills-90210-what-the-cast-is-doing-now-including-shannen-doherty"><em>Beverly Hills, 90210</em> cast</a> members to keep its promise. However, despite the fan service, the 2008-2013 series essentially recycled the plot of the original with a new ensemble of good-looking youths.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="odwGUxKtpe2xmwPAEoqT48" name="Roseanne Roseanne Barr looks over wistfully while sitting at a writing desk" alt="Roseanne Barr looks over wistfully while sitting at a writing desk in the Roseanne series finale." src="https://cdn.mos.cms.futurecdn.net/odwGUxKtpe2xmwPAEoqT48.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Full Moon and High Tide Productions)</span></figcaption></figure><h2 id="roseanne-1988-1997">Roseanne (1988-1997)</h2><p>While the series finale of <em>Roseanne</em> may have left some viewers disappointed, we wonder if that was really any reason to try again with a modern revival. Not to mention, the sitcom's 2018 reboot took a rough turn in its premiere run when its star, <a href="https://www.cinemablend.com/television/2494828/roseanne-still-sounds-bitter-about-what-happened-with-her-tv-show">Roseanne Barr, was fired</a> for a controversial tweet, leading ABC to kill off her character and rebrand the show as <em>The Conners</em>.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="iJV3YoMA42wuTEVS2YyAiW" name="farrah fawcett charlie's angels.png" alt="Farrah Fawcett in Charlie's Angels." src="https://cdn.mos.cms.futurecdn.net/iJV3YoMA42wuTEVS2YyAiW.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="charlie-s-angels-1976-1981">Charlie's Angels (1976-1981)</h2><p>Originally starring Farrah Fawcett, Kate Jackson, and Jaclyn Smith, <em>Charlie's Angels</em> would find success in the early 2000s on the big screen with two feature-length adaptations starring Cameron Diaz, Drew Barrymore, and Lucy Liu. However, ABC's series reboot from 2011 with Annie Ilonzeh, Minka Kelly, and Rachael Taylor received universal disdain and lasted only eight episodes.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="jq8T7pEHQ32A2KM6t3J4H7" name="raven (1).jpg" alt="Raven-Symone on That's So Raven" src="https://cdn.mos.cms.futurecdn.net/jq8T7pEHQ32A2KM6t3J4H7.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney)</span></figcaption></figure><h2 id="that-s-so-raven-2003-2007">That's So Raven (2003-2007)</h2><p>Years after launching her career on <em>The Cosby Show</em>, Raven-Symoné became the star of her own sitcom, <em>That's So Raven</em>, as a teen who can occasionally see the future. However, no one could predicted that, in 2017, Disney Channel would come out with <em>Raven's Home</em> – following the adult Raven Baxter as a single parent – which was a surprising success despite its unnecessary existence.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="ieYcBZq4zxDMiuZmTdZ5GL" name="Macgyver.jpg" alt="Richard Dean Anderson on MacGyver" src="https://cdn.mos.cms.futurecdn.net/ieYcBZq4zxDMiuZmTdZ5GL.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="macgyver-1985-1992">MacGyver (1985-1992)</h2><p>CBS would produce a long list of reboots of its most popular crime dramas from yesteryear, including <em>MacGyver</em>, which would last a decent five seasons from 2016 to 2021. However, most would agree that the modern version with Lucas Till as a younger Mac does not quite hold a candle to the fun of the original, starring Richard Dean Anderson as an unimaginably resourceful secret agent.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="nQuGbUtGneGia2p4CLhKgh" name="saved by the bell.jpg" alt="Saved by the Bell cast" src="https://cdn.mos.cms.futurecdn.net/nQuGbUtGneGia2p4CLhKgh.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="saved-by-the-bell-1989-1992">Saved By The Bell (1989-1992)</h2><p>Peacock's 2020 revival of NBC's hit coming-of-age sitcom, <em>Saved By the Bell</em>, while certainly unnecessary, was pretty well received during the short time it lasted. While <em>The College Years</em> could have been better, though, what really overstayed its welcome was <em>The New Class</em>, which replaced the entire cast, save Dennis Haskins as Mr. Belding and Dustin Diamond as Screech.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="8QNUDV7CGg5rx8QkpxndzN" name="vrobertenglund.jpg" alt="Robert Englund in V" src="https://cdn.mos.cms.futurecdn.net/8QNUDV7CGg5rx8QkpxndzN.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="v-1984-1985">V (1984-1985)</h2><p>The <em>V</em> franchise – an <a href="https://www.cinemablend.com/movies/things-that-might-happen-if-you-exist-in-an-alien-invasion-movie">alien invasion story</a> told over the course of two miniseries and one traditional series that lasted a season on NBC – would be reinterpreted for modern audiences on ABC in 2009. Of course, by then, the extraterrestrial visitors' true, malevolent intentions were no secret, leaving little room for suspense in the reboot.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="tBU4c6J7Do9cn5FFT3iNTE" name="beautyandthebeastperlmanhamilton" alt="Ron Perlman as Vincent and Linda Hamilton as Catherine alone in the sewer in Beauty and the Beast" src="https://cdn.mos.cms.futurecdn.net/tBU4c6J7Do9cn5FFT3iNTE.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="beauty-and-the-beast-1987-1990">Beauty And The Beast (1987-1990)</h2><p>The classic French fairy tale by Jeanne-Marie Leprince de Beaumont, <em>Beauty and the Beast</em>, was reimagined as a romantic contemporary drama in the late 1980s starring Ron Perlman and Linda Hamilton, the former of which won a Golden Globe for his performance. The CW's 2012 iteration with Kristin Kreuk and Jay Ryan would last a good while but did not capture the same magic as developer Ron Koslow's vision and, not to mention, did not bother to make the male lead particularly "beastly."</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="rXKJhyQdknK8shqpzAFDoL" name="roswelllizmax.jpg" alt="Shiri Appleby and Jason Behr on Roswell" src="https://cdn.mos.cms.futurecdn.net/rXKJhyQdknK8shqpzAFDoL.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: The WB)</span></figcaption></figure><h2 id="roswell-1999-2002">Roswell (1999-2002)</h2><p>Based on Melinda Metz's book series, The WB's <em>Roswell</em> follows three young human/alien hybrids with special gifts living in the eponymous New Mexico town where an alleged UFO crash took place. A reimagining of the story, <em>Roswell, New Mexico</em>, ran for four seasons on The CW and was admired for its commentary on immigration, only to be overshadowed by criticism for being a retread of what came before. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="d9sdwCCeM7fFhJP2XWjd84" name="Dallas.jpg" alt="Larry Hagman on Dallas" src="https://cdn.mos.cms.futurecdn.net/d9sdwCCeM7fFhJP2XWjd84.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="dallas-1978-1991">Dallas (1978-1991)</h2><p>In its prime, there were few series nearly as popular as <em>Dallas</em>, which is famous for having one of the <a href="https://www.cinemablend.com/television/best-cliffhangers-in-tv-history">most iconic cliffhangers in TV history</a> by leaving viewers obsessed with the mystery of who shot J.R. Ewing for a summer. We cannot quite say the same about TNT's revival, which was canceled after 40 episodes in 2014. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="AaoLapphvkQXv6zgckJ9JK" name="Tom Selleck Magnum PI.jpg" alt="Tom Selleck as Thomas Magnum smiling while driving on Magnum P.I." src="https://cdn.mos.cms.futurecdn.net/AaoLapphvkQXv6zgckJ9JK.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="magnum-p-i-1980-1988">Magnum P.I. (1980-1988)</h2><p>The Jay Hernandez-led reboot of <em>Magnum P.I.</em> lasted an impressive five seasons (originally on CBS before moving to NBC). However, even critics and audiences who enjoyed it agree it was mostly a watered-down carbon copy of Donald P. Bellisario and Glen A. Larson's '80s classic starring Tom Selleck as the titular Hawaii-based private investigator.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="mrVGQEEMTBojo6FXkKsDkd" name="Melrose Place Courtney Thorne-Smith watches Andrew Shue writing at the table.jpg" alt="Courtney Thorne-Smith watches Andrew Shue writing at the table in Melrose Place." src="https://cdn.mos.cms.futurecdn.net/mrVGQEEMTBojo6FXkKsDkd.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Spelling Television)</span></figcaption></figure><h2 id="melrose-place-1992-1999">Melrose Place (1992-1999)</h2><p>The 2009 reboot of <em>Melrose Place</em>, which followed the dramatic lives of the eponymous L.A. apartment complex's residents, only lasted 18 episodes. We imagine this might be because it premiered in such close proximity to another CW drama based on a hit '90s show about young people with problems: the <em>90210</em> reboot.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="pYVCypTpfc4sKUcZSdEtZT" name="KidsGameShows3.png" alt="Lynne Thigpen in Where in the World is Carmen Sandiego?" src="https://cdn.mos.cms.futurecdn.net/pYVCypTpfc4sKUcZSdEtZT.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: PBS)</span></figcaption></figure><h2 id="where-in-the-world-is-carmen-sandiego-1991-1996">Where In The World Is Carmen Sandiego? (1991-1996)</h2><p>Starting off as an educational computer game in the mid-1980s, <em>Where in the World is Carmen Sandiego?</em> was later adapted into a hit game show and an animated series featuring Rita Moreno as the titular thief. With all due respect to the developers of Netflix's animated reboot, <em>Carmen Sandiego</em>, and Gina Rodriguez, who is great in the title role, we cannot help but feel that the property was already past its prime by this point. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="tFUov8i7hdUskTjyyLpEje" name="Jack24S1.jpg" alt="Jack finding Teri's dead body in 24" src="https://cdn.mos.cms.futurecdn.net/tFUov8i7hdUskTjyyLpEje.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="24-2001-2010">24 (2001-2010)</h2><p>The unique, real-time narrative structure of <em>24</em> and Kiefer Sutherland's engaging performance as Jack Bauer kept the drama going for eight seasons before bringing the reckless counter-terrorism agent back for the 2014 miniseries, <em>24: Live Another Day</em>. Just two years later, Fox tried to continue the series as <em>24: Legacy</em>, led by Corey Hawkins in a new role, which only lasted "12 hours."</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="8syYMg2XtkKbrxSTPuip4K" name="ducktales.jpg" alt="Scrooge McDuck with Huey, Dewey and Louie" src="https://cdn.mos.cms.futurecdn.net/8syYMg2XtkKbrxSTPuip4K.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney Animation)</span></figcaption></figure><h2 id="ducktales-1987-1990">DuckTales (1987-1990)</h2><p>Perhaps we can understand wanting to introduce Huey, Dewey, and Louie to a new generation of viewers with a reboot of <em>DuckTales</em>, which aired on Disney XD from 2017 to 2021. However, we still prefer their triplets' original adventures with Uncle Scrooge, especially for its superior animation style.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="68a2tBecd4qkwRfmJFkegR" name="fantasyisland" alt="Ricardo Montalban as Mr. Roarke and Hervé Villechaize as Tattoo in white suits waiting for guests on Fantasy Island" src="https://cdn.mos.cms.futurecdn.net/68a2tBecd4qkwRfmJFkegR.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="fantasy-island-1977-1984">Fantasy Island (1977-1984)</h2><p>If we had a fantasy we would like to see come true, it would be that all reboots of <em>Fantasy Island</em> – set on a paradisiacal getaway where dreams magically come true – did not exist. Neither the 1998 series reimagining with Malcolm McDowell, nor Fox's sequel series with Roselyn Sánchez as Elena Roarke, or, especially, Blumhouse's darker feature adaptation managed to enchant critics and fans of the ABC original with Ricardo Montalbán as Mr. Roarke and Hervé Villechaize's Tattoo.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="3nWxuo856c7E6EuJUP35Ld" name="riderstrongbensavageboymeetsworld.jpg" alt="Rider Strong and Ben Savage on Boy Meets World" src="https://cdn.mos.cms.futurecdn.net/3nWxuo856c7E6EuJUP35Ld.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Michael Jacobs Productions)</span></figcaption></figure><h2 id="boy-meets-world-1993-2000">Boy Meets World (1993-2000)</h2><p>We would actually be willing to call <em>Girl Meets World</em>, which ran from 2014 to 2017, the best show that Disney Channel produced in years. Yet, when you really think about it, the sequel to <em>Boy Meets World</em> is mostly a reiteration of a lot of the same lessons we already learned in the original TGIF sitcom.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="vR3Q54RBumJm4MogXKu9ff" name="heroes-ss4.jpg" alt="Heroes" src="https://cdn.mos.cms.futurecdn.net/vR3Q54RBumJm4MogXKu9ff.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="heroes-2006-2010">Heroes (2006-2010)</h2><p>Despite a strong start and a relatively loyal following for much of its run, NBC's <em>Heroes</em> would quickly begin to lose steam as critics noted a steady decline in quality over time. The 2015 reboot <em>Heroes: Reborn</em> did not do much to help resurrect the franchise as it was not very well received and did not last more than one season.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="VvNg43YAY3cATox5DfvBkM" name="oddcoupleklugmanrandall" alt="Tony Randall as Felix disappointed that Jack Klugman as Oscar has sprayed disinfectant in his food on The Odd Couple" src="https://cdn.mos.cms.futurecdn.net/VvNg43YAY3cATox5DfvBkM.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="the-odd-couple-1970-1975">The Odd Couple (1970-1975)</h2><p>Inspired by the film based on Neil Simon's hilarious play, <em>The Odd Couple</em>, Garry Marshall and Jerry Belson's sitcom adaptation with Jack Klugman and Tony Randall worked quite well. However, after enough mismatched roommate/friend stories, CBS' reboot with Matthew Perry and Thomas Lennon, despite lasting three seasons, felt a bit stale.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="ZFWnkzGFqQ4Md6rb8bL54e" name="dynasty abc.png" alt="joan collins on dynasty" src="https://cdn.mos.cms.futurecdn.net/ZFWnkzGFqQ4Md6rb8bL54e.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="dynasty-1981-1989">Dynasty (1981-1989)</h2><p>Perhaps the most successful of The CW's string of primetime soap opera reboots was a reimagining of Esther and Richard Alan Shapiro's <em>Dyanasty</em>. Lasting five seasons and featuring a strong performance by Elizabeth Gillies as Fallon Carrington, the old "wealthy families fighting to retain power" schtick was not enough to win critics over.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Z5N8rM5pGdmNEuRuQarrjY" name="magic school bus.png" alt="Miss Frizzle in The Magic School Bus." src="https://cdn.mos.cms.futurecdn.net/Z5N8rM5pGdmNEuRuQarrjY.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: PBS)</span></figcaption></figure><h2 id="the-magic-school-bus-1994-1997">The Magic School Bus (1994-1997)</h2><p>In 2017, Netflix released <em>The Magic School Bus Rides Again</em> – a new take on the popular, educational animated show based on a series of books following an elementary school class on some epic field trips. <em>SNL</em>'s Kate McKinnon is certainly an inspired choice to voice the new Ms. Frizzle but even she might agree she is no Lily Tomlin. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="7Bo79xcrEE8shSoaTEZumC" name="iCarly_301_LR_1021_468_RT.jpg" alt="Carly smiling while holding a duster on iCarly." src="https://cdn.mos.cms.futurecdn.net/7Bo79xcrEE8shSoaTEZumC.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Paramount+)</span></figcaption></figure><h2 id="icarly-2007-2012">iCarly (2007-2012)</h2><p>Considering how much the world of internet blogging had evolved since <em>iCarly</em>'s original Nickelodeon run ended, we can understand why there was interest in bringing it back. Yet, we would argue that Paramount+'s reboot, which lasted from 2021 to 2023, suffered from hinging on Carly (Miranda Cosgrove) and Freddy's (Nathan Kress) romance following years of "will they, won't they" and the absence of Jennette McCurdy as Sam and Noah Munck's Gibby.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Upmdg9PfnSz3ng8fEioLCd" name="fresh-prince (1).jpg" alt="Will Smith on the Fresh Prince of Bel-Air." src="https://cdn.mos.cms.futurecdn.net/Upmdg9PfnSz3ng8fEioLCd.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="the-fresh-prince-of-bel-air-1990-1996">The Fresh Prince Of Bel-Air (1990-1996)</h2><p>When a short film reimagining NBC's hit sitcom <em>The Fresh Prince of Bel-Air</em> as a serious drama dropped in 2019, we can't deny we were intrigued. However, we never expected star Will Smith to actually help get a series adaptation off the ground, becoming Peacock's <em>Bel-Air,</em> which barely offers anything particularly new to the coming-of-age genre.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1278px;"><p class="vanilla-image-block" style="padding-top:56.34%;"><img id="MofgC3DuPB8UxvJEEW4A46" name="frasier-reboot.jpg" alt="Kelsey Grammer as Frasier Crane" src="https://cdn.mos.cms.futurecdn.net/MofgC3DuPB8UxvJEEW4A46.jpg" mos="" align="middle" fullscreen="" width="1278" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Paramount)</span></figcaption></figure><h2 id="frasier-1993-2004">Frasier (1993-2004)</h2><p>NBC's <em>Frasier</em>, starring Kelsey Grammer as his role from the <em>Cheers</em> cast, is a prime example of how to do a sitcom spin-off right. While Paramount+'s reboot would earn surprising critical acclaim, even its biggest fans might agree that we did not really need more than the 11 years we got of the eponymous psychiatrist's time in Seattle, especially without David Hyde Pierce and Jane Leeves.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
            </channel>
</rss>